BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0616 (641 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 22 4.4 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 5.8 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 5.8 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 5.8 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 37 LRLDQVLDTSFLMAAAFATKELTWFPSHAN 126 LR LD L+A + + WFP HA+ Sbjct: 150 LRQSSALDGVTLLADNSVSIKDPWFPRHAS 179 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -2 Query: 304 SSLNCYYCYVSHARSLQFAMT*ARRQ 227 S CY ++ HA +L ++ +RRQ Sbjct: 362 SGATCYALFLGHATNLIQSLDSSRRQ 387 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -2 Query: 304 SSLNCYYCYVSHARSLQFAMT*ARRQ 227 S CY ++ HA +L ++ +RRQ Sbjct: 330 SGATCYALFLGHATNLIQSLDSSRRQ 355 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 274 IRNNSSNSNWTNIGHDVFPAV 336 + NNS N N + D PA+ Sbjct: 538 VNNNSGNGNTNSSARDSSPAI 558 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,055 Number of Sequences: 438 Number of extensions: 3591 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -