BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0614 (579 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 3.3 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 5.7 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.2 bits (45), Expect = 3.3 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 481 YIFVLQWISSKETSRNKNKIWIK 549 Y V++W +++ S N +WIK Sbjct: 178 YDAVIKWSPNEDYSCEYNLVWIK 200 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.4 bits (43), Expect = 5.7 Identities = 17/66 (25%), Positives = 28/66 (42%), Gaps = 4/66 (6%) Frame = -3 Query: 223 FEKFFTTFFSRLYG----NTNFGQILRELRQS*LLQYKLFCSYRLYTPKSFYSSCINRKI 56 F F+ F + Y N + L E ++ L + CS PK + NR+ Sbjct: 32 FPNFYNDFEVQRYTWKCENQKCVKYLVEDEETSLATCNMLCSEPAIWPKPVHIKLTNRES 91 Query: 55 SIINRS 38 SII+++ Sbjct: 92 SIIDKT 97 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,436 Number of Sequences: 336 Number of extensions: 2748 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -