BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0613 (655 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Sc... 28 1.4 SPBC1105.08 |||EMP70 family|Schizosaccharomyces pombe|chr 2|||Ma... 27 3.1 SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual 26 4.1 SPCC777.02 |||transcription factor |Schizosaccharomyces pombe|ch... 25 7.2 SPAC26A3.01 |sxa1|SPAC2E1P5.06|aspartic protease Sxa1 |Schizosac... 25 9.5 SPAC22F3.03c |rdh54|tid1, mug34|ATP-dependent DNA helicase Rdh54... 25 9.5 SPAC4A8.08c |vas1||mitochondrial valine-tRNA ligase Vas1|Schizos... 25 9.5 >SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 997 Score = 27.9 bits (59), Expect = 1.4 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 588 NKKNVSRHGTPGRCETSTLFCKSNMQKE 505 +KK+V +PG CETS+ F K+ +KE Sbjct: 845 SKKDVET--SPGSCETSSAFAKTYAEKE 870 >SPBC1105.08 |||EMP70 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 629 Score = 26.6 bits (56), Expect = 3.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 458 ILFYHYDIFSSYHTICS 508 ILF HYDI YHT S Sbjct: 175 ILFNHYDIVIEYHTTSS 191 >SPBC26H8.04c |||DEP domain|Schizosaccharomyces pombe|chr 2|||Manual Length = 1496 Score = 26.2 bits (55), Expect = 4.1 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = +2 Query: 443 LFFRNILFYHYDIFSSYHTICSFCILLLQNNVDVSHLPG 559 +FFR+ D++ + +C C+ L Q + +PG Sbjct: 122 IFFRDQFISRSDMWKLFRELCGKCVYLKQRVSFIGDVPG 160 >SPCC777.02 |||transcription factor |Schizosaccharomyces pombe|chr 3|||Manual Length = 632 Score = 25.4 bits (53), Expect = 7.2 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -3 Query: 533 YFVKVICRKNRL-CDRN*ICHNDKIKYYEKII 441 +++ + CR+ ++ CD+N CHN + E II Sbjct: 23 HYLCLYCRRRKIKCDKNRPCHNCFVAKRECII 54 >SPAC26A3.01 |sxa1|SPAC2E1P5.06|aspartic protease Sxa1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 25.0 bits (52), Expect = 9.5 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +2 Query: 2 FFVSDFFIFNYSFKSSFKVKQEAIIIYNQSVRS 100 F SD+ FN+ + F V ++IY Q S Sbjct: 362 FSDSDYISFNFGSDADFHVSVNDLVIYRQESTS 394 >SPAC22F3.03c |rdh54|tid1, mug34|ATP-dependent DNA helicase Rdh54|Schizosaccharomyces pombe|chr 1|||Manual Length = 811 Score = 25.0 bits (52), Expect = 9.5 Identities = 8/33 (24%), Positives = 20/33 (60%) Frame = -3 Query: 563 GRLADVKHRHYFVKVICRKNRLCDRN*ICHNDK 465 G + V + Y++K++ R +++C+ + N+K Sbjct: 476 GFKSSVDQKGYYLKILTRLSKICNSTILLRNEK 508 >SPAC4A8.08c |vas1||mitochondrial valine-tRNA ligase Vas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 950 Score = 25.0 bits (52), Expect = 9.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 253 LRGRRMPWRRVAMRNRLCDSLPHDPALSHLSR 348 L+ R R + RNRL + +PH LS SR Sbjct: 354 LKARSKIVRLLQQRNRLVEQVPHSLILSVCSR 385 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,406,724 Number of Sequences: 5004 Number of extensions: 46935 Number of successful extensions: 126 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -