BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0613 (655 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF522196-1|AAN45861.1| 870|Homo sapiens scavenger receptor type... 32 2.1 AB052951-1|BAC53753.1| 866|Homo sapiens SRECRP-1 protein. 32 2.1 AB024433-1|BAD93345.1| 866|Homo sapiens NSR1 protein. 32 2.1 BC009326-1|AAH09326.2| 595|Homo sapiens SCARF2 protein protein. 31 2.7 >AF522196-1|AAN45861.1| 870|Homo sapiens scavenger receptor type F protein. Length = 870 Score = 31.9 bits (69), Expect = 2.1 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 3/66 (4%) Frame = -1 Query: 412 YCSKQHCIHYGVYTIGIRAQCSERDGLTPDRVGENRTVDCAWRRVATACVGHAEIGF--- 242 YC ++ C G Y +G R +C + G P V E R + C T C GF Sbjct: 268 YC-REPC-PAGFYGLGCRRRCGQCKGQQPCTVAEGRCLTCEPGWNGTKCDQPCATGFYGE 325 Query: 241 TCGYRC 224 C +RC Sbjct: 326 GCSHRC 331 >AB052951-1|BAC53753.1| 866|Homo sapiens SRECRP-1 protein. Length = 866 Score = 31.9 bits (69), Expect = 2.1 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 3/66 (4%) Frame = -1 Query: 412 YCSKQHCIHYGVYTIGIRAQCSERDGLTPDRVGENRTVDCAWRRVATACVGHAEIGF--- 242 YC ++ C G Y +G R +C + G P V E R + C T C GF Sbjct: 268 YC-REPC-PAGFYGLGCRRRCGQCKGQQPCTVAEGRCLTCEPGWNGTKCDQPCATGFYGE 325 Query: 241 TCGYRC 224 C +RC Sbjct: 326 GCSHRC 331 >AB024433-1|BAD93345.1| 866|Homo sapiens NSR1 protein. Length = 866 Score = 31.9 bits (69), Expect = 2.1 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 3/66 (4%) Frame = -1 Query: 412 YCSKQHCIHYGVYTIGIRAQCSERDGLTPDRVGENRTVDCAWRRVATACVGHAEIGF--- 242 YC ++ C G Y +G R +C + G P V E R + C T C GF Sbjct: 268 YC-REPC-PAGFYGLGCRRRCGQCKGQQPCTVAEGRCLTCEPGWNGTKCDQPCATGFYGE 325 Query: 241 TCGYRC 224 C +RC Sbjct: 326 GCSHRC 331 >BC009326-1|AAH09326.2| 595|Homo sapiens SCARF2 protein protein. Length = 595 Score = 31.5 bits (68), Expect = 2.7 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Frame = -1 Query: 382 GVYTIGIRAQCSERDGLTPDRVGENRTVDCAWRRVATACVGHAEIGF---TCGYRC 224 G Y +G R +C + G P V E R + C T C GF C +RC Sbjct: 5 GFYGLGCRRRCGQCKGQQPCTVAEGRCLTCEPGWNGTKCDQPCATGFYGEGCSHRC 60 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,036,757 Number of Sequences: 237096 Number of extensions: 1460346 Number of successful extensions: 6094 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6045 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6093 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7310122300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -