BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0611 (643 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27989| Best HMM Match : Involucrin2 (HMM E-Value=1.2) 48 9e-06 SB_770| Best HMM Match : DUF837 (HMM E-Value=1.4) 36 0.037 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_44266| Best HMM Match : PCI (HMM E-Value=0.047) 33 0.15 SB_55587| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.13) 32 0.46 SB_35254| Best HMM Match : Vicilin_N (HMM E-Value=0.066) 31 0.60 SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) 31 1.1 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 31 1.1 SB_59487| Best HMM Match : DUF1014 (HMM E-Value=2.4) 30 1.4 SB_5351| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_53319| Best HMM Match : zf-CW (HMM E-Value=7.7e-17) 29 2.4 SB_49640| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 29 2.4 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 29 2.4 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 29 2.4 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 29 3.2 SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_56774| Best HMM Match : DNA_pol_viral_N (HMM E-Value=0.41) 29 3.2 SB_39750| Best HMM Match : Borrelia_orfA (HMM E-Value=1.1) 29 3.2 SB_6450| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_29202| Best HMM Match : SH3_1 (HMM E-Value=3.9e-12) 29 4.2 SB_41695| Best HMM Match : Spectrin (HMM E-Value=0) 28 5.6 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_45585| Best HMM Match : Swi3 (HMM E-Value=0.37) 28 7.4 SB_6320| Best HMM Match : Exo_endo_phos (HMM E-Value=4.8) 28 7.4 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 28 7.4 SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 27 9.8 SB_54| Best HMM Match : Actin (HMM E-Value=0) 27 9.8 SB_42147| Best HMM Match : Thioredoxin (HMM E-Value=0.3) 27 9.8 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 27 9.8 SB_4834| Best HMM Match : Coiled (HMM E-Value=8.1) 27 9.8 >SB_27989| Best HMM Match : Involucrin2 (HMM E-Value=1.2) Length = 192 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/39 (48%), Positives = 34/39 (87%) Frame = -3 Query: 119 IMAENNKKIEEAQRKLAEERLAMIEEQRKMDEERQKLKK 3 ++AE +K +E+AQ+KLAEERLAM+EE+R +++++ L++ Sbjct: 120 LVAEKDKLLEDAQQKLAEERLAMVEERRTLNQQKADLER 158 >SB_770| Best HMM Match : DUF837 (HMM E-Value=1.4) Length = 269 Score = 35.5 bits (78), Expect = 0.037 Identities = 17/40 (42%), Positives = 28/40 (70%) Frame = -3 Query: 122 DIMAENNKKIEEAQRKLAEERLAMIEEQRKMDEERQKLKK 3 +I+ +N K+EE +L EE + M E QR+++EE++KL K Sbjct: 32 EILERDNGKLEERCDELFEEIVRMKESQREVEEEQEKLFK 71 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 33.5 bits (73), Expect = 0.15 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = -3 Query: 122 DIMAENNKKIEEAQRKLAEERLAMIEEQRKMDEERQKLK 6 D + + N++ EE QR+ EE + E+Q + +EE +K K Sbjct: 4529 DKLRQQNQEFEEEQRRRLEEEMGAFEKQLEEEEEEEKKK 4567 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/33 (45%), Positives = 23/33 (69%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQK 12 E ++E Q++ EERL EE+RKM+EER++ Sbjct: 1429 EAEMEMERLQKENEEERLRKEEEERKMEEERRR 1461 >SB_44266| Best HMM Match : PCI (HMM E-Value=0.047) Length = 205 Score = 33.5 bits (73), Expect = 0.15 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = -3 Query: 122 DIMAENNKKIEEAQRKLAEERLAMIEEQRKMDEERQ 15 + M E +K E+ +RK EERL E+ RK +EER+ Sbjct: 28 EAMREEQRKREDERRKREEERLEAEEKARKEEEERK 63 Score = 32.3 bits (70), Expect = 0.34 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = -3 Query: 89 EAQRKLAEERLAMIEEQRKMDEERQK 12 EA+R+ +ER AM EEQRK ++ER+K Sbjct: 18 EAERQDRKEREAMREEQRKREDERRK 43 >SB_55587| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.13) Length = 359 Score = 31.9 bits (69), Expect = 0.46 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQK 12 E ++E Q++ EERL +E+RKM+EER++ Sbjct: 243 EAEMEMERLQKENEEERLRKEKEERKMEEERRR 275 >SB_35254| Best HMM Match : Vicilin_N (HMM E-Value=0.066) Length = 909 Score = 31.5 bits (68), Expect = 0.60 Identities = 12/36 (33%), Positives = 25/36 (69%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQKLKK 3 E N+KIEEA+ K AE + + + ++++EE ++ ++ Sbjct: 540 EENRKIEEAKEKFAELQTRLAKSAKELEEELERKRE 575 >SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1501 Score = 31.1 bits (67), Expect = 0.80 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -3 Query: 122 DIMAENNKKIEEAQRKLAEERLAMIEEQRKMDEERQK 12 D + + + +RKLAEER + EE+R+ DE R++ Sbjct: 1176 DELRRKREDDDRGRRKLAEERRLLEEERRREDERRRE 1212 >SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/30 (43%), Positives = 23/30 (76%) Frame = -3 Query: 101 KKIEEAQRKLAEERLAMIEEQRKMDEERQK 12 ++I E +R+ EERL EE+R+++EER++ Sbjct: 1054 ERIAEQKRRDDEERLRREEEERRLEEERRR 1083 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQK 12 E +K EE +R+LAE+R E +RK +EE+++ Sbjct: 1096 EEERKREE-ERRLAEQRRVEEERRRKEEEEQRR 1127 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 3/35 (8%) Frame = -3 Query: 110 ENNKKIEEAQRKLAE---ERLAMIEEQRKMDEERQ 15 E +++EE +R+ E E + +EE+RK +EER+ Sbjct: 1072 EEERRLEEERRREEERKREEVRRLEEERKREEERR 1106 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/33 (39%), Positives = 24/33 (72%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQK 12 E +++EE +++ E RLA EQR+++EER++ Sbjct: 1090 EEVRRLEEERKREEERRLA---EQRRVEEERRR 1119 >SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) Length = 591 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/35 (48%), Positives = 24/35 (68%), Gaps = 2/35 (5%) Frame = -3 Query: 110 ENNKKIEEAQ--RKLAEERLAMIEEQRKMDEERQK 12 + K+IEE + RK AEE+ A EQR+M+EE +K Sbjct: 313 QEKKRIEEEEQKRKEAEEKKAKEIEQRRMEEEIKK 347 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQKLKK 3 E +K+EE +RK E+R E++++ EE +LK+ Sbjct: 418 EEKRKLEEQKRKEEEDRRRKEAEEKRIKEEEARLKE 453 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQKLKK 3 E +++EE QRK E++ EEQ++ + E +K K+ Sbjct: 300 ERIERVEEMQRKTQEKKRIEEEEQKRKEAEEKKAKE 335 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/33 (36%), Positives = 24/33 (72%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQK 12 E +++ EA+RK EE+ + E++RK +E+R++ Sbjct: 404 EEEERLVEARRKEQEEKRKLEEQKRKEEEDRRR 436 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/32 (46%), Positives = 23/32 (71%), Gaps = 2/32 (6%) Frame = -3 Query: 101 KKIEEAQRKLAEERLAMIEEQ--RKMDEERQK 12 K+I+E + +L EER + EE+ RK DEER++ Sbjct: 442 KRIKEEEARLKEERRSKDEEENRRKADEERKR 473 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Frame = -3 Query: 110 ENNKK-IEEAQRKLAEERL---AMIEEQRKMDEERQKLKK 3 EN KK I++ RKL EER EE+RK EE +K K+ Sbjct: 618 ENKKKEIDDEMRKLEEERTERDRQKEEERKRREEEEKKKR 657 >SB_59487| Best HMM Match : DUF1014 (HMM E-Value=2.4) Length = 176 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQK 12 E K++E+ QRK EE+ EEQRK +EE+QK Sbjct: 7 EEEKQLEK-QRKAEEEKRK--EEQRKAEEEKQK 36 >SB_5351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 870 Score = 29.9 bits (64), Expect = 1.8 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 5/42 (11%) Frame = -3 Query: 113 AENNKKIEEAQRKLAEE-----RLAMIEEQRKMDEERQKLKK 3 +EN K +EE +RK EE R +EEQR ++E+R K++K Sbjct: 415 SENRKTVEEKERKKKEEQEKIKREEELEEQR-LEEQRIKMQK 455 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/41 (41%), Positives = 28/41 (68%), Gaps = 3/41 (7%) Frame = -3 Query: 119 IMAENNKKIEEAQRKLAEERLAMIEEQ---RKMDEERQKLK 6 ++ E K++EE +R L EE+ M+EE+ R+ EE+QKL+ Sbjct: 276 LLEEEKKRLEELER-LKEEKDKMLEEELKKRETLEEKQKLQ 315 >SB_53319| Best HMM Match : zf-CW (HMM E-Value=7.7e-17) Length = 714 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/37 (35%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -3 Query: 110 ENNKKIE-EAQRKLAEERLAMIEEQRKMDEERQKLKK 3 + K++E E + +ER A E++R+++ ERQ++KK Sbjct: 139 KQKKRLEKEGDERKRKEREARAEKERELEMERQRIKK 175 >SB_49640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1177 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = -3 Query: 107 NNKKIEEAQRKLAEERLAMIEEQRKMDEERQKLK 6 NN+++E QR++ E+ AMI + ++ +E + LK Sbjct: 148 NNEELERRQREVEEKEHAMISRENELLQEIESLK 181 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = -3 Query: 122 DIMAENNKKIEEAQRKLAEERLAMIEEQRKMDEERQK 12 D + +N K +EE +++L E+ EE+R + ++RQK Sbjct: 147 DTIHDNEKFLEEQRKRLVEKVKNEGEEERMLHDQRQK 183 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 4/34 (11%) Frame = -3 Query: 92 EEAQRKLAEE-RLAM---IEEQRKMDEERQKLKK 3 EE RKL EE RLA +EE+RK++EER++ ++ Sbjct: 198 EERMRKLQEEARLAAQRALEEKRKLEEERKEQER 231 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/36 (38%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = -3 Query: 116 MAENNKKIEEAQRKLAEER-LAMIEEQRKMDEERQK 12 +AE+ +++EA+R+ AE + EE+R+ EERQ+ Sbjct: 374 VAEHVARLQEAERRRAEAKERERQEEERRKGEERQR 409 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQK 12 E ++ EE ++K EERL + E+++ ++ERQ+ Sbjct: 406 ERQRQEEEKRQKEEEERLRVEAERQREEDERQR 438 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = -3 Query: 122 DIMAENNKKIEEAQRKLAEERLAMIEEQRKMDEERQKLKK 3 +++ N+K EE +RKL EE +E R + EE + LK+ Sbjct: 3653 ELIEIENRKWEEERRKLKEEANYANKELRSIQEELRTLKR 3692 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 29.1 bits (62), Expect = 3.2 Identities = 11/34 (32%), Positives = 23/34 (67%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQKL 9 + +++EE Q + AEE L ++E+R+ E+ +K+ Sbjct: 1249 DEQRRLEEEQIREAEEELRRLQEEREYREQMRKI 1282 >SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1161 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 119 IMAENNKKIEEAQRKLAEERLAMIEEQRKMDEE 21 ++ E NKK++ KL+E + QRKM+EE Sbjct: 726 LLREENKKLQSEIDKLSESLEKSVAVQRKMEEE 758 >SB_56774| Best HMM Match : DNA_pol_viral_N (HMM E-Value=0.41) Length = 886 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/32 (46%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = -3 Query: 95 IEEAQRKLAEERLAMI-EEQRKMDEERQKLKK 3 IE+ +RKL EE+LA + EEQ + + E +K K+ Sbjct: 687 IEKRKRKLEEEKLAKLKEEQARKEAELEKEKQ 718 >SB_39750| Best HMM Match : Borrelia_orfA (HMM E-Value=1.1) Length = 810 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/32 (40%), Positives = 23/32 (71%) Frame = -3 Query: 107 NNKKIEEAQRKLAEERLAMIEEQRKMDEERQK 12 N +K E+AQ++ + +L IE RK++EE++K Sbjct: 5 NAEKEEKAQQEKKKRQLEAIELARKLEEEKKK 36 >SB_6450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 692 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = -3 Query: 101 KKIEEAQRKLAEERLAMIEEQRKMDEERQKLK 6 K+ EE +RK E RLA EE+++ E +KLK Sbjct: 91 KQAEERKRKNEERRLA-FEERKRQKEAEEKLK 121 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -3 Query: 116 MAENNKKIEEAQRKLAEERLAMIEEQRKMDEERQKLKK 3 + + K+++ + K AEER EE+R EER++ K+ Sbjct: 78 LQQRRDKVKQMREKQAEERKRKNEERRLAFEERKRQKE 115 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQKLKK 3 E ++ EE +++ EER EE++K +EE +K ++ Sbjct: 450 EEERREEEERKREEEERKQREEEEKKREEEERKQRE 485 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQK 12 E ++ EE +R+ EER EE+++ +EE +K Sbjct: 443 EEERRREEEERREEEERKREEEERKQREEEEKK 475 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQKLKK 3 E ++ EE +++ EER EE+RK E+ ++ K+ Sbjct: 465 ERKQREEEEKKREEEERKQREEEERKQKEKEEEKKR 500 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/31 (48%), Positives = 24/31 (77%), Gaps = 1/31 (3%) Frame = -3 Query: 92 EEAQRKLAEERLAMIEEQRKMDEE-RQKLKK 3 +EA+RK AEE+ IE Q+++DEE ++L+K Sbjct: 1226 KEAERK-AEEKRKQIERQKRIDEEVERRLQK 1255 >SB_52978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -3 Query: 92 EEAQRKLAEERLAMIEEQRKMDEERQK 12 EEAQR+ EE L EE+ + D ER++ Sbjct: 498 EEAQRREEEEALMKREEEERRDAERKR 524 Score = 27.5 bits (58), Expect = 9.8 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -3 Query: 89 EAQRKLAEERLAMIEEQRKMDEERQKLKK 3 EA+RK+ EE A + +Q+ ++ER + +K Sbjct: 525 EAERKIREEEEARLRKQKDEEDERTRREK 553 >SB_29202| Best HMM Match : SH3_1 (HMM E-Value=3.9e-12) Length = 364 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 620 YRAPPRGKRADQK 582 YRAPPRG+RA QK Sbjct: 18 YRAPPRGRRAHQK 30 >SB_41695| Best HMM Match : Spectrin (HMM E-Value=0) Length = 2322 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQKLK 6 E + E ++K EER EE+RK DE+ +K K Sbjct: 240 EEERAEAELKKKEEEERQRRAEEKRKNDEKEKKKK 274 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/39 (38%), Positives = 29/39 (74%), Gaps = 3/39 (7%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEE--RLAM-IEEQRKMDEERQKLKK 3 ++ K++ QR+ A+E ++AM +EE+RK +EE++K +K Sbjct: 123 KSKKQLLAEQRRRAKEMEQIAMELEEKRKEEEEKEKQRK 161 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 110 ENNKKIE-EAQRKLAEERLAMIEEQRKMDEERQK 12 + K++E E Q++L EER+ E+RK E QK Sbjct: 158 KQRKQLEVEKQKRLEEERIRSQNEERKRREREQK 191 >SB_45585| Best HMM Match : Swi3 (HMM E-Value=0.37) Length = 341 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/39 (35%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = -3 Query: 116 MAENNKKIEEAQRKLAEERLAMIEEQRKMDEERQK-LKK 3 + ++KK EE +RK EE+ +IE++ K ++ ++ LKK Sbjct: 221 LKRDSKKKEEEERKAREEKDKLIEKKMKSEQAYEEWLKK 259 >SB_6320| Best HMM Match : Exo_endo_phos (HMM E-Value=4.8) Length = 845 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -2 Query: 528 RSSKSRKGHILYRRLAVAMHRTIIRTTEKNPKDVAKWM 415 R + + LY+RL V T R T NP+ + WM Sbjct: 420 RDCRQQYKDALYKRLVVLTALTSCRKTASNPEGIPFWM 457 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEE-QRKMDEERQKLKK 3 E KK+EE + L EE EE ++K +EE +K ++ Sbjct: 239 EERKKLEEEEANLMEEERKRKEEAEKKREEEERKRRE 275 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = -3 Query: 122 DIMAENNKKIEEAQRKLAEE--RLAMIEEQRKMDEERQKLKK 3 +++ E + ++ +R L EE RL EE+RK EER+K K+ Sbjct: 582 NMIEEVHAVADQKERLLEEEKVRLKEEEEERKKQEERKKAKE 623 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = -3 Query: 122 DIMAENNKKIEEAQRKLAEERLAMIEEQRKMDEERQKLKK 3 ++M E K+ EEA++K EE ++R+ +E QK KK Sbjct: 250 NLMEEERKRKEEAEKKREEEE----RKRREEEEAAQKWKK 285 >SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1126 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQK 12 E KK E +L +R +EEQ+K EE++K Sbjct: 763 EKAKKERERMEQLEIQRQKKVEEQKKKREEKEK 795 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -3 Query: 110 ENNKKIEEAQRKLAEERLAMIEEQRKMDEERQKLKK 3 E ++ EAQ+KL EER EE R+ ++++L + Sbjct: 39 EERQREAEAQKKLEEERRQQEEEIRRARLQQERLSR 74 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/32 (40%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = -3 Query: 104 NKKIEEAQRKLAEERLAMIEEQRKM-DEERQK 12 NK+ +E + +++ ERL EEQ+++ DEE Q+ Sbjct: 1083 NKEQQELESRISLERLRYKEEQQRLRDEEEQQ 1114 >SB_42147| Best HMM Match : Thioredoxin (HMM E-Value=0.3) Length = 787 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -2 Query: 534 RERSSKSRKGHILYRRLAVAMHRTIIRTTEKNPKDVAKWMKSI 406 R+ + R+ YR + +HR I R T + + +W K+I Sbjct: 3 RDVKDEKRRSECAYRTSGLEVHRQIFRDTCQKYTKLLEWYKTI 45 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 27.5 bits (58), Expect = 9.8 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -3 Query: 122 DIMAENNKKI-EEAQRKLAEERLAMIEEQRKMDEERQKLKK 3 D ++ KK+ E + KLAEE ++Q + D+E++KL+K Sbjct: 514 DAPKKSKKKLTHEEKLKLAEEEKEKKKQQIQEDKEKKKLQK 554 >SB_4834| Best HMM Match : Coiled (HMM E-Value=8.1) Length = 221 Score = 27.5 bits (58), Expect = 9.8 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -3 Query: 620 YRAPPRGKRAD 588 YRAPPRG+RAD Sbjct: 18 YRAPPRGRRAD 28 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,102,692 Number of Sequences: 59808 Number of extensions: 174552 Number of successful extensions: 1203 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 934 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1189 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -