BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0610 (350 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0135 + 1039018-1041474 29 0.78 07_01_0168 + 1179292-1180354,1180880-1180923 26 7.2 01_05_0351 + 21269339-21269527,21269758-21269961 26 9.6 >06_01_0135 + 1039018-1041474 Length = 818 Score = 29.5 bits (63), Expect = 0.78 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = -2 Query: 274 DSVCRYQTPSSHINLVSPFYYCRGPCV*IDPLFVLRY*YMLISLACCLLV 125 D+V ++ +S IN +S +Y+ P V P F + ++L + C+ V Sbjct: 329 DAVAVFEVMNSEINFLSEYYHSVVPVVLASPFFFVANYFLLPVVVLCVCV 378 >07_01_0168 + 1179292-1180354,1180880-1180923 Length = 368 Score = 26.2 bits (55), Expect = 7.2 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 190 FIHTAHGNSKMDSRDLCAMMVFDNDR 267 F+HT HG+ +M+ + L +++ DR Sbjct: 316 FLHTIHGDYRMELKSLQISKLWEKDR 341 >01_05_0351 + 21269339-21269527,21269758-21269961 Length = 130 Score = 25.8 bits (54), Expect = 9.6 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -1 Query: 314 SPCSLSCVYASCP**CLSLSNTIIAHKSRESILLLP 207 SPCSL+ SCP L LS + A + + L LP Sbjct: 25 SPCSLAASAPSCPASRLGLSKKLEARELCRAELKLP 60 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,113,130 Number of Sequences: 37544 Number of extensions: 169357 Number of successful extensions: 317 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 317 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 518263348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -