BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0599 (637 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 54 4e-09 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 54 4e-09 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 54 4e-09 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 54 4e-09 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 50 5e-08 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 28 0.022 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 23 8.1 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 54.0 bits (124), Expect = 4e-09 Identities = 24/42 (57%), Positives = 28/42 (66%) Frame = +1 Query: 391 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTALG 516 HYT G E+VD VLD +RK + C LQGF + HS GGGT G Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSG 42 Score = 37.5 bits (83), Expect = 4e-04 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +3 Query: 510 SGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNS 632 SG +LL+ ++ +Y + +++ P+P+VS VVEPYN+ Sbjct: 41 SGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNA 81 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 54.0 bits (124), Expect = 4e-09 Identities = 24/42 (57%), Positives = 28/42 (66%) Frame = +1 Query: 391 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTALG 516 HYT G E+VD VLD +RK + C LQGF + HS GGGT G Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSG 42 Score = 37.5 bits (83), Expect = 4e-04 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +3 Query: 510 SGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNS 632 SG +LL+ ++ +Y + +++ P+P+VS VVEPYN+ Sbjct: 41 SGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNA 81 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 54.0 bits (124), Expect = 4e-09 Identities = 24/42 (57%), Positives = 28/42 (66%) Frame = +1 Query: 391 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTALG 516 HYT G E+VD VLD +RK + C LQGF + HS GGGT G Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSG 42 Score = 37.5 bits (83), Expect = 4e-04 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +3 Query: 510 SGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNS 632 SG +LL+ ++ +Y + +++ P+P+VS VVEPYN+ Sbjct: 41 SGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNA 81 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 54.0 bits (124), Expect = 4e-09 Identities = 24/42 (57%), Positives = 28/42 (66%) Frame = +1 Query: 391 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTALG 516 HYT G E+VD VLD +RK + C LQGF + HS GGGT G Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSG 42 Score = 37.5 bits (83), Expect = 4e-04 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +3 Query: 510 SGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNS 632 SG +LL+ ++ +Y + +++ P+P+VS VVEPYN+ Sbjct: 41 SGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNA 81 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 50.4 bits (115), Expect = 5e-08 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +2 Query: 74 MRECISVHVGQAGVQIGNACWE 139 MRECISVHVGQAGVQIGN CW+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 Score = 36.3 bits (80), Expect = 8e-04 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +3 Query: 129 PAGSFTAWSTASSLMARCPQTRPSGVETILSTLSSARPELASRTPC 266 P T WS AS+ RCP+TR S E +++ + + P LA + C Sbjct: 19 PCWDCTVWSMASNRTVRCPRTRRS--EAVMTRSTPSSPRLAQASTC 62 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 28.3 bits (60), Expect(2) = 0.022 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 180 CPQTRPSGVETILSTLSSARPELASRTPCCLR 275 C RPS ++ ++ S RP+LA+ + C R Sbjct: 164 CGSARPSRIDVAFASPSICRPDLAANSATCWR 195 Score = 21.8 bits (44), Expect(2) = 0.022 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 123 VMPAGSFTAWSTASSLMARCPQTRPSGV 206 V+ AG F AW TA +T+P G+ Sbjct: 116 VLLAGDFNAWHTAWG----SERTKPKGI 139 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 23.0 bits (47), Expect = 8.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 478 LIFHSFGGGTALGSLPY*WSVSPLT 552 L+ S+ G +PY WSV+ LT Sbjct: 446 LMLGSWPGAMHADDIPYLWSVTDLT 470 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 717,253 Number of Sequences: 2352 Number of extensions: 15619 Number of successful extensions: 32 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -