BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0598 (727 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY579077-1|AAT81601.1| 101|Anopheles gambiae neuropeptide F pro... 25 3.2 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 23 9.6 >AY579077-1|AAT81601.1| 101|Anopheles gambiae neuropeptide F protein. Length = 101 Score = 24.6 bits (51), Expect = 3.2 Identities = 10/27 (37%), Positives = 20/27 (74%) Frame = -3 Query: 365 ASGTFTRHIIKAFFVFFIGICNVSSII 285 ASGTFT+ ++ A +F + I ++S+++ Sbjct: 3 ASGTFTQRLLVALMIFAL-IADLSTLV 28 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 23.0 bits (47), Expect = 9.6 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = -3 Query: 485 YMFELSRSLFS*AVLRVLRSEQNYTHITVLSLTENFGFNNASGT 354 ++FE S L S V L SE Y +ITV L ++GT Sbjct: 574 FIFETSIKLVSVYVRHPLLSEYVYKNITVAPLVPTPCLEVSNGT 617 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 669,511 Number of Sequences: 2352 Number of extensions: 11741 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -