BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0597 (685 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 25 0.89 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 25 0.89 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 23 2.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 4.7 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 24.6 bits (51), Expect = 0.89 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -3 Query: 563 PSEDAHRLPDAG*WKVF*RGMYRTSSIPTLMVVPPLARQRTPSGSTTPVRS 411 P++ A RLP +K+ G + T ++ P + P+G TT V+S Sbjct: 184 PTDKALRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPAGLTTEVKS 234 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 24.6 bits (51), Expect = 0.89 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -3 Query: 563 PSEDAHRLPDAG*WKVF*RGMYRTSSIPTLMVVPPLARQRTPSGSTTPVRS 411 P++ A RLP +K+ G + T ++ P + P+G TT V+S Sbjct: 241 PTDKALRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPAGLTTEVKS 291 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 406 CPDRTGVVLPDGVLCLARGGTTI 474 CPD + L DG++C+ + TTI Sbjct: 64 CPDGLKL-LSDGLMCVEKVSTTI 85 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 139 LALCENRAAGIGIATSADYDIFVLKL 62 +A+ E G+A A YD VLKL Sbjct: 311 IAIKEKLVKDSGVAKDAAYDNIVLKL 336 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,119 Number of Sequences: 438 Number of extensions: 2989 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -