BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0592 (708 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 33 0.030 SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces ... 28 1.1 SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosacc... 27 3.5 SPAC2C4.13 |vma16||V-type ATPase subunit c''|Schizosaccharomyces... 26 4.6 SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein k... 26 6.1 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 33.5 bits (73), Expect = 0.030 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 9/75 (12%) Frame = +3 Query: 222 PLSRGG----PVPNSPIVSRITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGV 374 P+S GG P+P P+ S ++ H + + +L N I+L ++PLSP Sbjct: 160 PVSPGGSLVHPLPRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRS 219 Query: 375 IAKRPAPIALPNSCA 419 A+ P+PI L +S A Sbjct: 220 PARTPSPIRLYSSDA 234 >SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces pombe|chr 1|||Manual Length = 345 Score = 28.3 bits (60), Expect = 1.1 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 676 RVMVHVVGHRPDRRFFAL*RWSPRSLIVDSCSK 578 + +V + PD +FF + W P L + SC K Sbjct: 210 KFLVKLAKALPDAKFFGIFDWDPHGLCIYSCFK 242 >SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 732 Score = 26.6 bits (56), Expect = 3.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 353 PPFASWRNSEEARTDRPSQQLRSLN 427 PP AS RN E + PS+Q S+N Sbjct: 353 PPGASGRNRRERTSSTPSEQSTSVN 377 >SPAC2C4.13 |vma16||V-type ATPase subunit c''|Schizosaccharomyces pombe|chr 1|||Manual Length = 199 Score = 26.2 bits (55), Expect = 4.6 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -2 Query: 605 FFNSGLLFQTGTTLNPISVYSFDL*GILPISAFG 504 F NSG F G+ L S Y++ L GI AFG Sbjct: 24 FHNSGESFDFGSFLLDTSPYTWGLLGIASCVAFG 57 >SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein kinase Ppk5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 836 Score = 25.8 bits (54), Expect = 6.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 613 SPRSLIVDSCSKLEQHSTLSRSILLI 536 SP +L +CS L HST + L+ Sbjct: 28 SPNNLTEQTCSPLRAHSTFKEPVFLL 53 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,045,111 Number of Sequences: 5004 Number of extensions: 66012 Number of successful extensions: 124 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -