BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0592 (708 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) 138 3e-33 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 138 5e-33 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 137 9e-33 SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) 137 9e-33 SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) 137 9e-33 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 136 1e-32 SB_43137| Best HMM Match : No HMM Matches (HMM E-Value=.) 136 1e-32 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 136 1e-32 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 136 2e-32 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 136 2e-32 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 136 2e-32 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 136 2e-32 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 136 2e-32 SB_31140| Best HMM Match : No HMM Matches (HMM E-Value=.) 136 2e-32 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 136 2e-32 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 136 2e-32 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 136 2e-32 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 136 2e-32 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 136 2e-32 SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) 136 2e-32 SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) 136 2e-32 SB_12156| Best HMM Match : No HMM Matches (HMM E-Value=.) 136 2e-32 SB_10540| Best HMM Match : No HMM Matches (HMM E-Value=.) 136 2e-32 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 3e-32 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 3e-32 SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 3e-32 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 3e-32 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 3e-32 SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 3e-32 SB_30964| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 3e-32 SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 3e-32 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 3e-32 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 3e-32 SB_6561| Best HMM Match : HEAT (HMM E-Value=0.028) 135 3e-32 SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 3e-32 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 4e-32 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 4e-32 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 4e-32 SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 4e-32 SB_56306| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 4e-32 SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 4e-32 SB_34810| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 4e-32 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 135 4e-32 SB_28913| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 4e-32 SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 4e-32 SB_4147| Best HMM Match : No HMM Matches (HMM E-Value=.) 135 4e-32 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 134 5e-32 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 134 5e-32 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 134 5e-32 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 134 5e-32 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 134 5e-32 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 134 5e-32 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 134 5e-32 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 134 5e-32 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 134 5e-32 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 134 5e-32 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 134 5e-32 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 134 5e-32 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 134 5e-32 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 134 5e-32 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 134 5e-32 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 134 5e-32 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 134 5e-32 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 134 5e-32 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 134 5e-32 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 134 5e-32 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 134 5e-32 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 134 5e-32 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 134 5e-32 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 134 5e-32 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 134 5e-32 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 134 5e-32 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 134 5e-32 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 134 5e-32 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 134 5e-32 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 134 5e-32 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 134 5e-32 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 134 5e-32 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 134 5e-32 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 134 5e-32 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 134 5e-32 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 134 5e-32 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 134 5e-32 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 134 5e-32 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_25922| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_25468| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 134 5e-32 SB_25275| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_24506| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_23850| Best HMM Match : SMP (HMM E-Value=4.9) 134 5e-32 SB_23569| Best HMM Match : PAN (HMM E-Value=0.0015) 134 5e-32 SB_23505| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 134 5e-32 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 134 5e-32 SB_23034| Best HMM Match : Cyclotide (HMM E-Value=3.9) 134 5e-32 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 134 5e-32 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 134 5e-32 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_22390| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_22377| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 134 5e-32 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_21996| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_21918| Best HMM Match : STT3 (HMM E-Value=0) 134 5e-32 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_21857| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_21818| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 134 5e-32 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_21155| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_21127| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_20660| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_20556| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_20335| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_20328| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 134 5e-32 SB_19740| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_19737| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_19598| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_19225| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 134 5e-32 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_17851| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_17561| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_17547| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 134 5e-32 SB_17396| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_17369| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_17363| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 134 5e-32 SB_16189| Best HMM Match : rve (HMM E-Value=0.3) 134 5e-32 SB_16122| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_16111| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 134 5e-32 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_15736| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_15584| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_15560| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 134 5e-32 SB_15427| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_15387| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8) 134 5e-32 SB_14602| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_14378| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_14253| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 134 5e-32 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_13737| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_13672| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_13401| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 134 5e-32 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 134 5e-32 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 134 5e-32 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 134 5e-32 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_12508| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) 134 5e-32 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 134 5e-32 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 134 5e-32 >SB_14278| Best HMM Match : DUF1328 (HMM E-Value=6.3) Length = 177 Score = 138 bits (335), Expect = 3e-33 Identities = 74/122 (60%), Positives = 84/122 (68%) Frame = +2 Query: 71 QKESVDGGHIKGKTKLLFLFNSEHFHIYLPFKPSLDFHE*FKIKISQIGPAALEGGPGTQ 250 +K S+ +K K LF + F + L F ++F + S+ A+E Q Sbjct: 20 RKISMLSATVKLAAKPLFAYALVIFLVILAFASLIEFLQPGGSTSSRAAATAVE----LQ 75 Query: 251 FAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 430 FA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG Sbjct: 76 FALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNG 135 Query: 431 EW 436 EW Sbjct: 136 EW 137 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 138 bits (333), Expect = 5e-33 Identities = 71/99 (71%), Positives = 77/99 (77%), Gaps = 3/99 (3%) Frame = +2 Query: 149 IYLPF---KPSLDFHE*FKIKISQIGPAALEGGPGTQFAYSESYYNSLAVVLQRRDWENP 319 +YL F KPS++F + S+ A+E QFA ESYYNSLAVVLQRRDWENP Sbjct: 14 VYLLFDATKPSIEFLQPGGSTSSRAAATAVE----LQFALYESYYNSLAVVLQRRDWENP 69 Query: 320 GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 70 GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 137 bits (331), Expect = 9e-33 Identities = 69/103 (66%), Positives = 75/103 (72%), Gaps = 4/103 (3%) Frame = +2 Query: 140 HFHIYLPFKPSLDFHE*FKIKISQIGPAALEGGPGT----QFAYSESYYNSLAVVLQRRD 307 H H+Y+ + + KI+ Q G + T QFA ESYYNSLAVVLQRRD Sbjct: 26 HGHLYIRATHACCHDKVVKIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRD 85 Query: 308 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 86 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 128 >SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 137 bits (331), Expect = 9e-33 Identities = 66/84 (78%), Positives = 69/84 (82%), Gaps = 3/84 (3%) Frame = +2 Query: 194 KIKISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFA 364 K+ +S P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFA Sbjct: 38 KLYVSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFA 97 Query: 365 SWRNSEEARTDRPSQQLRSLNGEW 436 SWRNSEEARTDRPSQQLRSLNGEW Sbjct: 98 SWRNSEEARTDRPSQQLRSLNGEW 121 >SB_42907| Best HMM Match : TFIIS_C (HMM E-Value=0.98) Length = 519 Score = 137 bits (331), Expect = 9e-33 Identities = 68/90 (75%), Positives = 70/90 (77%), Gaps = 4/90 (4%) Frame = +2 Query: 179 FHE*FKIKISQIGPAALEGGPGT----QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLA 346 FHE I+ Q G + T QFA ESYYNSLAVVLQRRDWENPGVTQLNRLA Sbjct: 276 FHEQVDIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLA 335 Query: 347 AHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 AHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 336 AHPPFASWRNSEEARTDRPSQQLRSLNGEW 365 >SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 136 bits (330), Expect = 1e-32 Identities = 65/76 (85%), Positives = 66/76 (86%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + AYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_43137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 136 bits (330), Expect = 1e-32 Identities = 67/87 (77%), Positives = 70/87 (80%), Gaps = 3/87 (3%) Frame = +2 Query: 185 E*FKIKISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHP 355 E F + +S P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 40 ESFGLFVSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHP 99 Query: 356 PFASWRNSEEARTDRPSQQLRSLNGEW 436 PFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 100 PFASWRNSEEARTDRPSQQLRSLNGEW 126 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 136 bits (330), Expect = 1e-32 Identities = 70/103 (67%), Positives = 76/103 (73%), Gaps = 3/103 (2%) Frame = +2 Query: 137 EHFHIYLPFKPSLDFHE*FKIKISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRD 307 EHF + +P + S+ + S P LE P + YSESYYNSLAVVLQRRD Sbjct: 22 EHFSLVVPKQESIRSNS-----CSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRD 76 Query: 308 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 77 WENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 119 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 136 bits (329), Expect = 2e-32 Identities = 70/104 (67%), Positives = 78/104 (75%), Gaps = 4/104 (3%) Frame = +2 Query: 137 EHFHIY----LPFKPSLDFHE*FKIKISQIGPAALEGGPGTQFAYSESYYNSLAVVLQRR 304 ++FHI L F+ ++F + S+ A+E QFA ESYYNSLAVVLQRR Sbjct: 53 DYFHILQGEQLAFRAGIEFLQPGGSTSSRAAATAVE----LQFALYESYYNSLAVVLQRR 108 Query: 305 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 109 DWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 152 >SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 136 bits (329), Expect = 2e-32 Identities = 65/83 (78%), Positives = 69/83 (83%), Gaps = 3/83 (3%) Frame = +2 Query: 197 IKISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 367 +++S P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS Sbjct: 81 VELSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 140 Query: 368 WRNSEEARTDRPSQQLRSLNGEW 436 WRNSEEARTDRPSQQLRSLNGEW Sbjct: 141 WRNSEEARTDRPSQQLRSLNGEW 163 >SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 136 bits (329), Expect = 2e-32 Identities = 67/91 (73%), Positives = 72/91 (79%), Gaps = 3/91 (3%) Frame = +2 Query: 173 LDFHE*FKIKISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRL 343 +++ E + KI P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRL Sbjct: 46 VEWPETWPFKIIPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRL 105 Query: 344 AAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 AAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 106 AAHPPFASWRNSEEARTDRPSQQLRSLNGEW 136 >SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) Length = 699 Score = 136 bits (329), Expect = 2e-32 Identities = 66/84 (78%), Positives = 69/84 (82%), Gaps = 3/84 (3%) Frame = +2 Query: 194 KIKISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFA 364 +I I+ P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFA Sbjct: 576 RIAINPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFA 635 Query: 365 SWRNSEEARTDRPSQQLRSLNGEW 436 SWRNSEEARTDRPSQQLRSLNGEW Sbjct: 636 SWRNSEEARTDRPSQQLRSLNGEW 659 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 136 bits (329), Expect = 2e-32 Identities = 68/93 (73%), Positives = 69/93 (74%), Gaps = 3/93 (3%) Frame = +2 Query: 167 PSLDFHE*FKIKISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLN 337 P D H S P LE P + YSESYYNSLAVVLQRRDWENPGVTQLN Sbjct: 17 PICDCHAHVSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 76 Query: 338 RLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 RLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 77 RLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_31140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 136 bits (329), Expect = 2e-32 Identities = 66/82 (80%), Positives = 68/82 (82%), Gaps = 3/82 (3%) Frame = +2 Query: 200 KISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASW 370 KI+ P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 99 KITPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASW 158 Query: 371 RNSEEARTDRPSQQLRSLNGEW 436 RNSEEARTDRPSQQLRSLNGEW Sbjct: 159 RNSEEARTDRPSQQLRSLNGEW 180 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 136 bits (328), Expect = 2e-32 Identities = 71/110 (64%), Positives = 80/110 (72%), Gaps = 1/110 (0%) Frame = +2 Query: 110 TKLLFLFNSEHFHIY-LPFKPSLDFHE*FKIKISQIGPAALEGGPGTQFAYSESYYNSLA 286 T +L + + F I+ K S++F + S+ A+E QFA ESYYNSLA Sbjct: 107 TPVLGIHHIHQFQIFTFLLKESIEFLQPGGSTSSRAAATAVE----LQFALYESYYNSLA 162 Query: 287 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 163 VVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 212 >SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) Length = 340 Score = 136 bits (328), Expect = 2e-32 Identities = 67/90 (74%), Positives = 72/90 (80%), Gaps = 4/90 (4%) Frame = +2 Query: 179 FHE*FKIKISQIG-PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLA 346 F++ K++ G P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLA Sbjct: 211 FYQKIAKKVANPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLA 270 Query: 347 AHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 AHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 271 AHPPFASWRNSEEARTDRPSQQLRSLNGEW 300 >SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 136 bits (328), Expect = 2e-32 Identities = 69/96 (71%), Positives = 71/96 (73%), Gaps = 3/96 (3%) Frame = +2 Query: 158 PFKPSLDFHE*FKIKISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVT 328 P K S+ F S P LE P + YSESYYNSLAVVLQRRDWENPGVT Sbjct: 33 PVKVSISFF--LSNSCSPGDPLVLERSPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVT 90 Query: 329 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 91 QLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 126 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 136 bits (328), Expect = 2e-32 Identities = 65/77 (84%), Positives = 67/77 (87%) Frame = +2 Query: 206 SQIGPAALEGGPGTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 385 S+ P A+E QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE Sbjct: 44 SRAAPTAVE----LQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 99 Query: 386 ARTDRPSQQLRSLNGEW 436 ARTDRPSQQLRSLNGEW Sbjct: 100 ARTDRPSQQLRSLNGEW 116 >SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) Length = 153 Score = 136 bits (328), Expect = 2e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 11 PLVLEXAPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 70 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 71 RTDRPSQQLRSLNGEW 86 >SB_7650| Best HMM Match : SLR1-BP (HMM E-Value=0.71) Length = 439 Score = 136 bits (328), Expect = 2e-32 Identities = 67/102 (65%), Positives = 76/102 (74%) Frame = +2 Query: 131 NSEHFHIYLPFKPSLDFHE*FKIKISQIGPAALEGGPGTQFAYSESYYNSLAVVLQRRDW 310 N H+ + ++ ++F + S+ A+E QFA ESYYNSLAVVLQRRDW Sbjct: 215 NKTHYSVRHTYENRIEFLQPGGSTSSRAAATAVE----LQFALYESYYNSLAVVLQRRDW 270 Query: 311 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 271 ENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 312 >SB_24086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 136 bits (328), Expect = 2e-32 Identities = 67/91 (73%), Positives = 73/91 (80%) Frame = +2 Query: 164 KPSLDFHE*FKIKISQIGPAALEGGPGTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRL 343 KP+++F + S+ A+E QFA ESYYNSLAVVLQRRDWENPGVTQLNRL Sbjct: 12 KPTIEFLQPGGSTSSRAAATAVE----LQFALYESYYNSLAVVLQRRDWENPGVTQLNRL 67 Query: 344 AAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 AAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 68 AAHPPFASWRNSEEARTDRPSQQLRSLNGEW 98 >SB_12156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 136 bits (328), Expect = 2e-32 Identities = 72/109 (66%), Positives = 79/109 (72%), Gaps = 5/109 (4%) Frame = +2 Query: 125 LFNSEHFHIYLPFKPSLD--FHE*FKIKISQIGPAALEGGP---GTQFAYSESYYNSLAV 289 + + E F+ +P SL FH + +S P LE P + YSESYYNSLAV Sbjct: 69 VLSKEFFYGCIPAHNSLKPGFHI-VETFVSPGDPLVLERPPPRWSSNSPYSESYYNSLAV 127 Query: 290 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 128 VLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 176 >SB_10540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 136 bits (328), Expect = 2e-32 Identities = 69/99 (69%), Positives = 73/99 (73%), Gaps = 4/99 (4%) Frame = +2 Query: 152 YLPFKPSLDFHE*FKIKISQIGPAALEGGPGT----QFAYSESYYNSLAVVLQRRDWENP 319 Y KP + H+ I+ Q G + T QFA ESYYNSLAVVLQRRDWENP Sbjct: 12 YRTLKPKM--HDQIHIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENP 69 Query: 320 GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 70 GVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 135 bits (327), Expect = 3e-32 Identities = 67/85 (78%), Positives = 69/85 (81%), Gaps = 6/85 (7%) Frame = +2 Query: 200 KISQIGPA---ALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 361 K+S GP LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF Sbjct: 60 KLSSTGPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 119 Query: 362 ASWRNSEEARTDRPSQQLRSLNGEW 436 ASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 120 ASWRNSEEARTDRPSQQLRSLNGEW 144 >SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 135 bits (327), Expect = 3e-32 Identities = 66/82 (80%), Positives = 67/82 (81%), Gaps = 3/82 (3%) Frame = +2 Query: 200 KISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASW 370 KI P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 74 KICPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASW 133 Query: 371 RNSEEARTDRPSQQLRSLNGEW 436 RNSEEARTDRPSQQLRSLNGEW Sbjct: 134 RNSEEARTDRPSQQLRSLNGEW 155 >SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 135 bits (327), Expect = 3e-32 Identities = 70/105 (66%), Positives = 77/105 (73%), Gaps = 3/105 (2%) Frame = +2 Query: 131 NSEHFHIYLPFKPSLDFHE*FKIKISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQR 301 ++ H H++LP+ P + S P LE P + YSESYYNSLAVVLQR Sbjct: 154 STAHAHMHLPW-PLCPYSG----STSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQR 208 Query: 302 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 209 RDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 253 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 135 bits (327), Expect = 3e-32 Identities = 62/71 (87%), Positives = 63/71 (88%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 428 GEWQIVSVNIL 460 GEW + L Sbjct: 114 GEWDAPCIGAL 124 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 135 bits (327), Expect = 3e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 24 PLVLERAPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 83 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 84 RTDRPSQQLRSLNGEW 99 >SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 135 bits (327), Expect = 3e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 31 PLVLERAPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 90 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 91 RTDRPSQQLRSLNGEW 106 >SB_30964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 135 bits (327), Expect = 3e-32 Identities = 66/81 (81%), Positives = 67/81 (82%), Gaps = 3/81 (3%) Frame = +2 Query: 203 ISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR 373 IS P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR Sbjct: 159 ISPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWR 218 Query: 374 NSEEARTDRPSQQLRSLNGEW 436 NSEEARTDRPSQQLRSLNGEW Sbjct: 219 NSEEARTDRPSQQLRSLNGEW 239 >SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 135 bits (327), Expect = 3e-32 Identities = 72/127 (56%), Positives = 80/127 (62%), Gaps = 3/127 (2%) Frame = +2 Query: 65 NKQKESVDGGHIKGKTKLLFLFNSEHFHIYLPFKPSLDFHE*FKIKISQIGPAALEGGP- 241 N+ S+ KL+ ++H + K L + S P LE P Sbjct: 7 NRATNSIKKAKATYNRKLIERNGNDHRTFWKTLKKILPGEKKTSNSCSPGDPLVLERPPP 66 Query: 242 --GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 415 + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL Sbjct: 67 RWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQL 126 Query: 416 RSLNGEW 436 RSLNGEW Sbjct: 127 RSLNGEW 133 >SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 135 bits (327), Expect = 3e-32 Identities = 62/71 (87%), Positives = 63/71 (88%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 428 GEWQIVSVNIL 460 GEW + L Sbjct: 114 GEWDAPCIGAL 124 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 135 bits (327), Expect = 3e-32 Identities = 69/88 (78%), Positives = 70/88 (79%), Gaps = 7/88 (7%) Frame = +2 Query: 194 KIKISQI----GPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAH 352 KIKIS P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAH Sbjct: 65 KIKISNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAH 124 Query: 353 PPFASWRNSEEARTDRPSQQLRSLNGEW 436 PPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 125 PPFASWRNSEEARTDRPSQQLRSLNGEW 152 >SB_6561| Best HMM Match : HEAT (HMM E-Value=0.028) Length = 1444 Score = 135 bits (327), Expect = 3e-32 Identities = 64/79 (81%), Positives = 68/79 (86%), Gaps = 3/79 (3%) Frame = +2 Query: 209 QIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 379 ++G + LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS Sbjct: 1327 RLGRSVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 1386 Query: 380 EEARTDRPSQQLRSLNGEW 436 EEARTDRPSQQLRSLNGEW Sbjct: 1387 EEARTDRPSQQLRSLNGEW 1405 >SB_5609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 135 bits (327), Expect = 3e-32 Identities = 67/85 (78%), Positives = 70/85 (82%), Gaps = 4/85 (4%) Frame = +2 Query: 194 KIKISQIG-PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 361 +I+ Q G P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF Sbjct: 31 RIEFLQPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPF 90 Query: 362 ASWRNSEEARTDRPSQQLRSLNGEW 436 ASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 91 ASWRNSEEARTDRPSQQLRSLNGEW 115 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 135 bits (326), Expect = 4e-32 Identities = 65/82 (79%), Positives = 68/82 (82%), Gaps = 3/82 (3%) Frame = +2 Query: 200 KISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASW 370 +I+ P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 56 RITPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASW 115 Query: 371 RNSEEARTDRPSQQLRSLNGEW 436 RNSEEARTDRPSQQLRSLNGEW Sbjct: 116 RNSEEARTDRPSQQLRSLNGEW 137 >SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 135 bits (326), Expect = 4e-32 Identities = 74/115 (64%), Positives = 84/115 (73%), Gaps = 3/115 (2%) Frame = +2 Query: 101 KGK--TKLLFLFNSEHFHIYLPFK-PSLDFHE*FKIKISQIGPAALEGGPGTQFAYSESY 271 KGK T ++ +F ++H I L F ++F + S+ A+E QFA ESY Sbjct: 4 KGKFDTTVIVVF-AKHVSIVLKFNFCKIEFLQPGGSTSSRAAATAVE----LQFALYESY 58 Query: 272 YNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 YNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 59 YNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 113 >SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 135 bits (326), Expect = 4e-32 Identities = 71/111 (63%), Positives = 78/111 (70%), Gaps = 3/111 (2%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 49 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 108 Query: 389 RTDRPSQQLRSLNGEWQIVSVNILLKFALNFC*ISSFFNQRPKSAKSLINQ 541 RTDRPSQQLRSLNGEW L AL +S ++ S+ + +NQ Sbjct: 109 RTDRPSQQLRSLNGEWDAPCSGALSAAAL----FASAEKRKTSSSTARLNQ 155 >SB_24727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 135 bits (326), Expect = 4e-32 Identities = 66/86 (76%), Positives = 69/86 (80%), Gaps = 4/86 (4%) Frame = +2 Query: 191 FKIKISQIGPAALEGGPGT----QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPP 358 F+I+ Q G + T QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPP Sbjct: 2 FRIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPP 61 Query: 359 FASWRNSEEARTDRPSQQLRSLNGEW 436 FASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 62 FASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_56306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 135 bits (326), Expect = 4e-32 Identities = 64/83 (77%), Positives = 69/83 (83%), Gaps = 3/83 (3%) Frame = +2 Query: 197 IKISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 367 ++++ P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS Sbjct: 2 LEVNPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFAS 61 Query: 368 WRNSEEARTDRPSQQLRSLNGEW 436 WRNSEEARTDRPSQQLRSLNGEW Sbjct: 62 WRNSEEARTDRPSQQLRSLNGEW 84 >SB_55485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 135 bits (326), Expect = 4e-32 Identities = 66/94 (70%), Positives = 73/94 (77%) Frame = +2 Query: 155 LPFKPSLDFHE*FKIKISQIGPAALEGGPGTQFAYSESYYNSLAVVLQRRDWENPGVTQL 334 + + P ++F + S+ A+E QFA ESYYNSLAVVLQRRDWENPGVTQL Sbjct: 24 IQYNPEIEFLQPGGSTSSRAAATAVE----LQFALYESYYNSLAVVLQRRDWENPGVTQL 79 Query: 335 NRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 NRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 80 NRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 113 >SB_34810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 135 bits (326), Expect = 4e-32 Identities = 67/93 (72%), Positives = 72/93 (77%) Frame = +2 Query: 158 PFKPSLDFHE*FKIKISQIGPAALEGGPGTQFAYSESYYNSLAVVLQRRDWENPGVTQLN 337 PF ++F + S+ A+E QFA ESYYNSLAVVLQRRDWENPGVTQLN Sbjct: 3 PFSKPIEFLQPGGSTSSRAAATAVE----LQFALYESYYNSLAVVLQRRDWENPGVTQLN 58 Query: 338 RLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 436 RLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 59 RLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 91 >SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) Length = 263 Score = 135 bits (326), Expect = 4e-32 Identities = 67/91 (73%), Positives = 68/91 (74%), Gaps = 3/91 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 24 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 83 Query: 389 RTDRPSQQLRSLNGEWQIVSVNILLKFALNF 481 RTDRPSQQLRSLNGEW L L F Sbjct: 84 RTDRPSQQLRSLNGEWDAPCSGALSAAELTF 114 >SB_28913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 135 bits (326), Expect = 4e-32 Identities = 67/86 (77%), Positives = 69/86 (80%), Gaps = 4/86 (4%) Frame = +2 Query: 191 FKIKISQIG-PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPP 358 F+I G P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPP Sbjct: 70 FEIAAESPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPP 129 Query: 359 FASWRNSEEARTDRPSQQLRSLNGEW 436 FASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 130 FASWRNSEEARTDRPSQQLRSLNGEW 155 >SB_16933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 135 bits (326), Expect = 4e-32 Identities = 66/86 (76%), Positives = 69/86 (80%), Gaps = 4/86 (4%) Frame = +2 Query: 191 FKIKISQIGPAALEGGPGT----QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPP 358 F+I+ Q G + T QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPP Sbjct: 14 FRIEFLQPGGSTSSRAAATAVELQFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPP 73 Query: 359 FASWRNSEEARTDRPSQQLRSLNGEW 436 FASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 74 FASWRNSEEARTDRPSQQLRSLNGEW 99 >SB_4147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 135 bits (326), Expect = 4e-32 Identities = 67/88 (76%), Positives = 68/88 (77%), Gaps = 3/88 (3%) Frame = +2 Query: 182 HE*FKIKISQIGPAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAH 352 HE S P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAH Sbjct: 15 HEQTSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAH 74 Query: 353 PPFASWRNSEEARTDRPSQQLRSLNGEW 436 PPFASWRNSEEARTDRPSQQLRSLNGEW Sbjct: 75 PPFASWRNSEEARTDRPSQQLRSLNGEW 102 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 24 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 83 Query: 428 GEW 436 GEW Sbjct: 84 GEW 86 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 20 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 79 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 80 RTDRPSQQLRSLNGEW 95 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 428 GEW 436 GEW Sbjct: 85 GEW 87 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 51 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 110 Query: 428 GEW 436 GEW Sbjct: 111 GEW 113 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 43 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 102 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 103 RTDRPSQQLRSLNGEW 118 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 86 Query: 428 GEW 436 GEW Sbjct: 87 GEW 89 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 34 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 93 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 94 RTDRPSQQLRSLNGEW 109 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 59 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 118 Query: 428 GEW 436 GEW Sbjct: 119 GEW 121 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 35 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 94 Query: 428 GEW 436 GEW Sbjct: 95 GEW 97 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 11 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 70 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 71 RTDRPSQQLRSLNGEW 86 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 26 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 85 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 86 RTDRPSQQLRSLNGEW 101 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 35 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 94 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 95 RTDRPSQQLRSLNGEW 110 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 42 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 101 Query: 428 GEW 436 GEW Sbjct: 102 GEW 104 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 117 Query: 428 GEW 436 GEW Sbjct: 118 GEW 120 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 105 Query: 428 GEW 436 GEW Sbjct: 106 GEW 108 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 16 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 75 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 76 RTDRPSQQLRSLNGEW 91 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 192 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 251 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 252 RTDRPSQQLRSLNGEW 267 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 87 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 146 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 147 RTDRPSQQLRSLNGEW 162 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 23 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 82 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 83 RTDRPSQQLRSLNGEW 98 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 357 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 416 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 417 RTDRPSQQLRSLNGEW 432 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 131 Query: 428 GEW 436 GEW Sbjct: 132 GEW 134 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 15 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 74 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 75 RTDRPSQQLRSLNGEW 90 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 14 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 73 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 74 RTDRPSQQLRSLNGEW 89 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 92 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 151 Query: 428 GEW 436 GEW Sbjct: 152 GEW 154 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 21 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 80 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 81 RTDRPSQQLRSLNGEW 96 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 316 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 375 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 376 RTDRPSQQLRSLNGEW 391 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 56 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 115 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 116 RTDRPSQQLRSLNGEW 131 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 26 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 85 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 86 RTDRPSQQLRSLNGEW 101 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 35 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 94 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 95 RTDRPSQQLRSLNGEW 110 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 19 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 78 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 79 RTDRPSQQLRSLNGEW 94 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 110 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 169 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 170 RTDRPSQQLRSLNGEW 185 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 39 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 98 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 99 RTDRPSQQLRSLNGEW 114 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 15 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 74 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 75 RTDRPSQQLRSLNGEW 90 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 132 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 191 Query: 428 GEW 436 GEW Sbjct: 192 GEW 194 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 49 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 108 Query: 428 GEW 436 GEW Sbjct: 109 GEW 111 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 82 Query: 428 GEW 436 GEW Sbjct: 83 GEW 85 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 62 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 121 Query: 428 GEW 436 GEW Sbjct: 122 GEW 124 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 45 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 104 Query: 428 GEW 436 GEW Sbjct: 105 GEW 107 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 58 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 117 Query: 428 GEW 436 GEW Sbjct: 118 GEW 120 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 98 Query: 428 GEW 436 GEW Sbjct: 99 GEW 101 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 12 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 71 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 72 RTDRPSQQLRSLNGEW 87 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 26 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 85 Query: 428 GEW 436 GEW Sbjct: 86 GEW 88 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 90 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 149 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 150 RTDRPSQQLRSLNGEW 165 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 106 Query: 428 GEW 436 GEW Sbjct: 107 GEW 109 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 10 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 69 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 70 RTDRPSQQLRSLNGEW 85 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 372 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 431 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 432 RTDRPSQQLRSLNGEW 447 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 34 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 93 Query: 428 GEW 436 GEW Sbjct: 94 GEW 96 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 102 Query: 428 GEW 436 GEW Sbjct: 103 GEW 105 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 428 GEW 436 GEW Sbjct: 85 GEW 87 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 95 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 154 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 155 RTDRPSQQLRSLNGEW 170 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 44 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 103 Query: 428 GEW 436 GEW Sbjct: 104 GEW 106 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 428 GEW 436 GEW Sbjct: 114 GEW 116 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 57 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 116 Query: 428 GEW 436 GEW Sbjct: 117 GEW 119 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 390 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 449 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 450 RTDRPSQQLRSLNGEW 465 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 100 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 159 Query: 428 GEW 436 GEW Sbjct: 160 GEW 162 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 56 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 115 Query: 428 GEW 436 GEW Sbjct: 116 GEW 118 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 32 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 91 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 92 RTDRPSQQLRSLNGEW 107 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 22 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 81 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 82 RTDRPSQQLRSLNGEW 97 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 428 GEW 436 GEW Sbjct: 114 GEW 116 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 41 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 100 Query: 428 GEW 436 GEW Sbjct: 101 GEW 103 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 39 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 98 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 99 RTDRPSQQLRSLNGEW 114 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 90 Query: 428 GEW 436 GEW Sbjct: 91 GEW 93 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 161 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 220 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 221 RTDRPSQQLRSLNGEW 236 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 10 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 69 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 70 RTDRPSQQLRSLNGEW 85 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 16 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 75 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 76 RTDRPSQQLRSLNGEW 91 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 30 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 89 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 90 RTDRPSQQLRSLNGEW 105 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 27 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 86 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 87 RTDRPSQQLRSLNGEW 102 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 82 Query: 428 GEW 436 GEW Sbjct: 83 GEW 85 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 11 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 70 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 71 RTDRPSQQLRSLNGEW 86 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 25 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 84 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 85 RTDRPSQQLRSLNGEW 100 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 15 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 74 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 75 RTDRPSQQLRSLNGEW 90 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 89 Query: 428 GEW 436 GEW Sbjct: 90 GEW 92 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 60 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 119 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 120 RTDRPSQQLRSLNGEW 135 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 316 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 375 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 376 RTDRPSQQLRSLNGEW 391 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 98 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 157 Query: 428 GEW 436 GEW Sbjct: 158 GEW 160 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 62 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 121 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 122 RTDRPSQQLRSLNGEW 137 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 12 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 71 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 72 RTDRPSQQLRSLNGEW 87 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 270 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 329 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 330 RTDRPSQQLRSLNGEW 345 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 33 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 92 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 93 RTDRPSQQLRSLNGEW 108 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 47 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 106 Query: 428 GEW 436 GEW Sbjct: 107 GEW 109 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 428 GEW 436 GEW Sbjct: 85 GEW 87 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 387 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 446 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 447 RTDRPSQQLRSLNGEW 462 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 84 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 143 Query: 428 GEW 436 GEW Sbjct: 144 GEW 146 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 27 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 86 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 87 RTDRPSQQLRSLNGEW 102 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 19 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 78 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 79 RTDRPSQQLRSLNGEW 94 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 32 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 91 Query: 428 GEW 436 GEW Sbjct: 92 GEW 94 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 187 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 246 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 247 RTDRPSQQLRSLNGEW 262 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 19 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 78 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 79 RTDRPSQQLRSLNGEW 94 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 86 Query: 428 GEW 436 GEW Sbjct: 87 GEW 89 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 19 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 78 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 79 RTDRPSQQLRSLNGEW 94 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 136 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 195 Query: 428 GEW 436 GEW Sbjct: 196 GEW 198 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 21 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 80 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 81 RTDRPSQQLRSLNGEW 96 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 11 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 70 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 71 RTDRPSQQLRSLNGEW 86 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 44 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 103 Query: 428 GEW 436 GEW Sbjct: 104 GEW 106 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 171 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 230 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 231 RTDRPSQQLRSLNGEW 246 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 88 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 89 RTDRPSQQLRSLNGEW 104 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 25 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 84 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 85 RTDRPSQQLRSLNGEW 100 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 163 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 222 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 223 RTDRPSQQLRSLNGEW 238 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 43 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 102 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 103 RTDRPSQQLRSLNGEW 118 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 26 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 85 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 86 RTDRPSQQLRSLNGEW 101 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 52 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 111 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 112 RTDRPSQQLRSLNGEW 127 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 72 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 131 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 132 RTDRPSQQLRSLNGEW 147 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 25 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 84 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 85 RTDRPSQQLRSLNGEW 100 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 639 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 698 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 699 RTDRPSQQLRSLNGEW 714 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 24 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 83 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 84 RTDRPSQQLRSLNGEW 99 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 13 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 72 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 73 RTDRPSQQLRSLNGEW 88 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 27 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 86 Query: 428 GEW 436 GEW Sbjct: 87 GEW 89 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 12 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 71 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 72 RTDRPSQQLRSLNGEW 87 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 19 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 78 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 79 RTDRPSQQLRSLNGEW 94 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 31 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 90 Query: 428 GEW 436 GEW Sbjct: 91 GEW 93 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 45 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 104 Query: 428 GEW 436 GEW Sbjct: 105 GEW 107 >SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 39 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 98 Query: 428 GEW 436 GEW Sbjct: 99 GEW 101 >SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 115 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 174 Query: 428 GEW 436 GEW Sbjct: 175 GEW 177 >SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 157 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 216 Query: 428 GEW 436 GEW Sbjct: 217 GEW 219 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 56 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 115 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 116 RTDRPSQQLRSLNGEW 131 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 21 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 80 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 81 RTDRPSQQLRSLNGEW 96 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 51 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 110 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 111 RTDRPSQQLRSLNGEW 126 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 901 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 960 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 961 RTDRPSQQLRSLNGEW 976 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 22 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 81 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 82 RTDRPSQQLRSLNGEW 97 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 25 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 84 Query: 428 GEW 436 GEW Sbjct: 85 GEW 87 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 72 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 131 Query: 428 GEW 436 GEW Sbjct: 132 GEW 134 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 428 GEW 436 GEW Sbjct: 114 GEW 116 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 51 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 110 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 111 RTDRPSQQLRSLNGEW 126 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 102 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 161 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 162 RTDRPSQQLRSLNGEW 177 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 73 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 132 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 133 RTDRPSQQLRSLNGEW 148 >SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 46 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 105 Query: 428 GEW 436 GEW Sbjct: 106 GEW 108 >SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 30 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 89 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 90 RTDRPSQQLRSLNGEW 105 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 23 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 82 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 83 RTDRPSQQLRSLNGEW 98 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 884 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 943 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 944 RTDRPSQQLRSLNGEW 959 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 15 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 74 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 75 RTDRPSQQLRSLNGEW 90 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 19 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 78 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 79 RTDRPSQQLRSLNGEW 94 >SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 30 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 89 Query: 428 GEW 436 GEW Sbjct: 90 GEW 92 >SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 57 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 116 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 117 RTDRPSQQLRSLNGEW 132 >SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) Length = 180 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 78 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 137 Query: 428 GEW 436 GEW Sbjct: 138 GEW 140 >SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 452 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 511 Query: 428 GEW 436 GEW Sbjct: 512 GEW 514 >SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 32 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 91 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 92 RTDRPSQQLRSLNGEW 107 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 26 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 85 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 86 RTDRPSQQLRSLNGEW 101 >SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 28 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 87 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 88 RTDRPSQQLRSLNGEW 103 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 72 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 131 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 132 RTDRPSQQLRSLNGEW 147 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 51 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 110 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 111 RTDRPSQQLRSLNGEW 126 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 34 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 93 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 94 RTDRPSQQLRSLNGEW 109 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 47 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 106 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 107 RTDRPSQQLRSLNGEW 122 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 23 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 82 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 83 RTDRPSQQLRSLNGEW 98 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 88 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 89 RTDRPSQQLRSLNGEW 104 >SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 32 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 91 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 92 RTDRPSQQLRSLNGEW 107 >SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 43 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 102 Query: 428 GEW 436 GEW Sbjct: 103 GEW 105 >SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 28 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 87 Query: 428 GEW 436 GEW Sbjct: 88 GEW 90 >SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 38 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 97 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 98 RTDRPSQQLRSLNGEW 113 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 49 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 108 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 109 RTDRPSQQLRSLNGEW 124 >SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 23 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 82 Query: 428 GEW 436 GEW Sbjct: 83 GEW 85 >SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 48 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 107 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 108 RTDRPSQQLRSLNGEW 123 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 33 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 92 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 93 RTDRPSQQLRSLNGEW 108 >SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) Length = 872 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 757 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 816 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 817 RTDRPSQQLRSLNGEW 832 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 23 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 82 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 83 RTDRPSQQLRSLNGEW 98 >SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) Length = 372 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 47 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 106 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 107 RTDRPSQQLRSLNGEW 122 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 150 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 209 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 210 RTDRPSQQLRSLNGEW 225 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 10 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 69 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 70 RTDRPSQQLRSLNGEW 85 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 91 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 150 Query: 428 GEW 436 GEW Sbjct: 151 GEW 153 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 428 GEW 436 GEW Sbjct: 114 GEW 116 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 18 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 77 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 78 RTDRPSQQLRSLNGEW 93 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 54 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 113 Query: 428 GEW 436 GEW Sbjct: 114 GEW 116 >SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 134 bits (325), Expect = 5e-32 Identities = 64/76 (84%), Positives = 65/76 (85%), Gaps = 3/76 (3%) Frame = +2 Query: 218 PAALEGGP---GTQFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 388 P LE P + YSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 5 PLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 64 Query: 389 RTDRPSQQLRSLNGEW 436 RTDRPSQQLRSLNGEW Sbjct: 65 RTDRPSQQLRSLNGEW 80 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 134 bits (325), Expect = 5e-32 Identities = 61/63 (96%), Positives = 61/63 (96%) Frame = +2 Query: 248 QFAYSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 427 QFA ESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN Sbjct: 56 QFALYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLN 115 Query: 428 GEW 436 GEW Sbjct: 116 GEW 118 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,978,729 Number of Sequences: 59808 Number of extensions: 490801 Number of successful extensions: 5364 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5342 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -