BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0590 (664 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1069 - 8420454-8420670,8421272-8421447,8421556-8421738,842... 29 3.3 >01_01_1069 - 8420454-8420670,8421272-8421447,8421556-8421738, 8421885-8421980,8422064-8422192,8422266-8422445, 8422524-8422634,8422714-8422869,8422983-8423078, 8423160-8423327,8423402-8423642,8423724-8423851, 8424042-8424134,8424214-8424309,8424431-8424523, 8424741-8424850,8424999-8425134,8425215-8425315, 8426029-8426152,8426237-8426411,8426523-8426681, 8427423-8427536,8427669-8427848,8428926-8429005 Length = 1113 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -3 Query: 287 SVIVMPLFRNDE-I*SAFFNFILICNYYFYCLFLQFLPYPPYSLFLVFNHMQSNN 126 +V + L +ND + SA + + N + + F+P PP S FL F H Q NN Sbjct: 817 AVPCIALSKNDSYVMSACGGKVSLFNMMTFKVMTTFMPPPPASTFLAF-HPQDNN 870 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,243,268 Number of Sequences: 37544 Number of extensions: 195145 Number of successful extensions: 479 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 479 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1667659452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -