BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0590 (664 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10... 30 1.2 At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 ... 29 3.6 >At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 30.3 bits (65), Expect = 1.2 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -3 Query: 287 SVIVMPLFRNDE-I*SAFFNFILICNYYFYCLFLQFLPYPPYSLFLVFNHMQSNN 126 SV + L +ND + SA + + N + + F+P PP S FL F H Q NN Sbjct: 833 SVPCIALSKNDSYVMSACGGKVSLFNMMTFKVMTTFMPPPPASTFLAF-HPQDNN 886 >At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 WD-40 repeats (PF00400) (2 weak) Length = 1108 Score = 28.7 bits (61), Expect = 3.6 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -3 Query: 269 LFRNDE-I*SAFFNFILICNYYFYCLFLQFLPYPPYSLFLVFNHMQSNN 126 L +ND + SA + + N + + F+P PP S FL F H Q NN Sbjct: 828 LSKNDSYVMSAAGGKVSLFNMMTFKVMTTFMPPPPASTFLAF-HPQDNN 875 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,304,115 Number of Sequences: 28952 Number of extensions: 170458 Number of successful extensions: 368 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 368 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1393347168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -