BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0588 (578 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 27 0.10 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 22 3.8 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 22 3.8 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 22 3.8 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 21 6.7 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 6.7 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 27.5 bits (58), Expect = 0.10 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = +3 Query: 384 PR*VPVGERHAGRGPGQHAPGRLRVRAGAGPADS--HHQAGALSSPSDCMSPGH 539 P VPVG AG G PG GA +D + + SPS + P H Sbjct: 54 PPSVPVGSAVAGTAGGALFPGMAAAGKGAARSDDWLANANSPVGSPSAALQPQH 107 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 22.2 bits (45), Expect = 3.8 Identities = 15/64 (23%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = -1 Query: 542 MVSGAHAVGGRGERSRLVMGVCRPSAGPNAEPPRCVLPRPSPGMPFSD-RNSSRSTYLRS 366 +V G + +G + C P GPN P PS + +D R + + ++ + Sbjct: 24 LVVGPYVIGLMNTMTHTTNAFCLPFCGPNVINPFFCDMSPSLSLLCADTRLNKLAVFIVA 83 Query: 365 GS*G 354 G+ G Sbjct: 84 GAVG 87 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 506 ERSRLVMGVCRPSAG 462 ER++ VMG C P++G Sbjct: 105 ERAQSVMGKCLPTSG 119 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 506 ERSRLVMGVCRPSAG 462 ER++ VMG C P++G Sbjct: 105 ERAQSVMGKCLPTSG 119 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/33 (27%), Positives = 13/33 (39%) Frame = -1 Query: 542 MVSGAHAVGGRGERSRLVMGVCRPSAGPNAEPP 444 +V G + +G + C P GPN P Sbjct: 23 LVVGPYVIGLMNTMTHTTNAFCLPFCGPNVINP 55 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 6.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 386 RSTYLRSGS*GRVLSHRLGPKKAACASQ 303 RST+L+ RV S R ++ +C SQ Sbjct: 386 RSTHLKVSGINRVGSTRRPSRRNSCESQ 413 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.317 0.137 0.423 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,962 Number of Sequences: 438 Number of extensions: 2361 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16748661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -