Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0586
         (605 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_0969 - 29787617-29787919,29788019-29788180,29788962-297890...    28   6.6  

>04_04_0969 -
           29787617-29787919,29788019-29788180,29788962-29789093,
           29789708-29789760,29790518-29791007
          Length = 379

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = +3

Query: 414 GGARYPIRPIVSRITIHWPSFYNVVTGKTLAF-PT*SPCSTSPFRQLALIAKRARTDP 584
           GG   P  P  +   +  P   NV+ G  L+F P  SP ++SP +   +     RTDP
Sbjct: 20  GGVMMPQHPYGAAPAMP-PGSANVMHGVPLSFNPMASPTASSPMKPADMSGTMYRTDP 76


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,810,301
Number of Sequences: 37544
Number of extensions: 351455
Number of successful extensions: 614
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 599
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 614
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1442939384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)