BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0577 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding pr... 29 0.15 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 24 3.2 >AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding protein AgamOBP41 protein. Length = 279 Score = 28.7 bits (61), Expect = 0.15 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = +1 Query: 112 EPIDIYNVNALSTLRYEF*GLKYSYNGCPALQTETHYCFTAEIG 243 +P D YNVN T E L+ + C L E+ C+ G Sbjct: 101 DPADAYNVNRTETCLQELPALELNAEKCCGLAFESFLCYYYNYG 144 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 24.2 bits (50), Expect = 3.2 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +1 Query: 73 GRSHSPPGVKRLLEPIDIYNVNALSTLRYEF*GLKYSYNGCP-ALQTETH 219 G H P + P+++Y V + R+ F + + + CP LQ E H Sbjct: 257 GTYHDPKKNETTQTPLEVYTVRRGARFRFRF--INAASHVCPLQLQIEDH 304 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 658,780 Number of Sequences: 2352 Number of extensions: 13767 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -