BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0574 (611 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.4 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 3.1 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 7.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.2 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 7.2 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.5 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 9.5 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 351 LRVAPEEHPVLLTEAPLNPKANREKM 428 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.6 bits (46), Expect = 3.1 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -2 Query: 262 IPLCYVPHLLHKSPSVPYRPSRP 194 +P Y PH H S P+R S P Sbjct: 312 LPPSYHPHQHHPSQYHPHRGSSP 334 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 554 VGDTVAGVQHDTGGTTGRVQREHGLDGDVHG 462 VGD +A ++ D G + E+G G G Sbjct: 42 VGDDIAWMKFDKEGRLRAINPEYGFFGVAPG 72 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = +2 Query: 509 SYHRYRAGLRRRCLPHRAHLRRIRTPPRHP 598 ++HR C P +L +I + P HP Sbjct: 67 AHHRLYPAFSSSCDPVPGNLEQIGSRPLHP 96 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 7.2 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 115 GMCKAGFAGD 144 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 174 DRGEHGARSIISCETGLA 121 D GEH ++ E GLA Sbjct: 130 DPGEHNGDTVTDVEAGLA 147 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 174 DRGEHGARSIISCETGLA 121 D GEH ++ E GLA Sbjct: 125 DPGEHNGDTVTDVEAGLA 142 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,175 Number of Sequences: 438 Number of extensions: 4692 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -