BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0571 (648 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccha... 29 0.58 SPAPB18E9.05c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 27 2.3 SPAC8F11.04 |||U3 snoRNP-associated protein Cic1/Utp30 family |S... 26 4.1 SPAC2F7.06c |pol4||DNA polymerase X family|Schizosaccharomyces p... 25 7.1 SPBC557.03c |pim1|dcd1, ptr2|GDP/GTP exchange factor |Schizosacc... 25 7.1 SPCC320.08 |||membrane transporter |Schizosaccharomyces pombe|ch... 25 7.1 SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3 ... 25 9.4 SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces... 25 9.4 >SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 4196 Score = 29.1 bits (62), Expect = 0.58 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -1 Query: 342 LVVSTDKKSHFTMGSN*VPVVTLNNEFEKVYSCTL 238 ++ STDK FT G+ P+ + N+EF V+S L Sbjct: 2317 ILSSTDKMLSFTSGATNYPLGSSNDEFSTVFSKVL 2351 >SPAPB18E9.05c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 90 Score = 27.1 bits (57), Expect = 2.3 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = +2 Query: 8 IVLMDKRFRSLIGFGVIPFK*MFLLRILLSIDRYSH 115 +V M FRS I FGV F FL+RIL I YS+ Sbjct: 44 LVSMSWLFRSTICFGVSLFLSFFLVRILWGI-AYSY 78 >SPAC8F11.04 |||U3 snoRNP-associated protein Cic1/Utp30 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 373 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 99 MLKRILNKNIYLKGITPKPIKL 34 ML RIL K Y K P P+K+ Sbjct: 149 MLPRILGKTFYQKSKVPVPVKI 170 >SPAC2F7.06c |pol4||DNA polymerase X family|Schizosaccharomyces pombe|chr 1|||Manual Length = 506 Score = 25.4 bits (53), Expect = 7.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 94 KHRPLFTCKAFIGLYFYHDF 153 KH+ FT + +GL FY DF Sbjct: 293 KHKDSFTKQIKVGLEFYEDF 312 >SPBC557.03c |pim1|dcd1, ptr2|GDP/GTP exchange factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 539 Score = 25.4 bits (53), Expect = 7.1 Identities = 10/26 (38%), Positives = 20/26 (76%) Frame = -1 Query: 93 KRILNKNIYLKGITPKPIKLRNRLSI 16 +R+L + L+G+TP+P+ L+N +S+ Sbjct: 260 RRMLERR-RLQGLTPQPLALKNIISV 284 >SPCC320.08 |||membrane transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 505 Score = 25.4 bits (53), Expect = 7.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 46 FWSNTFQINVFVKNPFKHRPLFTCKAFIGLYFYHDF 153 FWS I+VF + + P+ +GL+ YH F Sbjct: 399 FWSLVIGIHVFGYHVYWLYPIAFVLIILGLFVYHVF 434 >SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 932 Score = 25.0 bits (52), Expect = 9.4 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 539 YRAPPRVNSISQ 504 Y APPRVNSIS+ Sbjct: 212 YMAPPRVNSISR 223 >SPAC890.08 |rpl31||60S ribosomal protein L31|Schizosaccharomyces pombe|chr 1|||Manual Length = 113 Score = 25.0 bits (52), Expect = 9.4 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 84 LNKNIYLKGITPKPIKLRNRLSIK 13 LNK ++ +GI P +LR RLS K Sbjct: 60 LNKEVWKRGIRNVPHRLRLRLSRK 83 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,658,860 Number of Sequences: 5004 Number of extensions: 54419 Number of successful extensions: 99 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -