BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0569 (678 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49232| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_49232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 313 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 153 ERHSHSHGVVSHIYATVNLSRWQRSTS*CV 242 +R SH+H + ++ + LSRW R S CV Sbjct: 158 QRTSHAHQISRNMSINLTLSRWLRKMSMCV 187 >SB_40725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 649 IPNMVKKIDLAPTVESDA-AAIPEIKTPEAADAPKLADNPVDEDKPA 512 +P VK++ P + + +K P A AP P D DKPA Sbjct: 338 VPEPVKEVPARPVTKQEPFKQTKPVKEPSLAPAPTANMVPSDRDKPA 384 >SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1766 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -2 Query: 305 REGVKRRTRVDSLRHASLLAANTLTRAPLPTREINCSV 192 R+GV+ D LRH SLL+A+T LP E N + Sbjct: 1231 RQGVE--LSADILRHISLLSASTAPYYQLPEDEYNVEI 1266 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,085,129 Number of Sequences: 59808 Number of extensions: 243697 Number of successful extensions: 698 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 696 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -