BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0567 (690 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0231 - 1730428-1730817 29 3.5 12_02_0390 - 18510095-18510148,18510318-18512450,18513018-185136... 29 4.6 10_08_0496 - 18328875-18328907,18329056-18329106,18329562-183296... 29 4.6 >05_01_0231 - 1730428-1730817 Length = 129 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +1 Query: 319 GDSLRACHVKITSTHSTLHHLIPTVCIQEHNLGNIVDQLCTSLQDIKD 462 GD R C K+ + LH L+ V +H G I+ + +SLQ+I D Sbjct: 80 GDRNRLCGEKLKKRY--LHELLRDVEPDDHKHGGILQRCKSSLQEIVD 125 >12_02_0390 - 18510095-18510148,18510318-18512450,18513018-18513681, 18514089-18514202,18514835-18514979,18515274-18515331 Length = 1055 Score = 28.7 bits (61), Expect = 4.6 Identities = 20/55 (36%), Positives = 26/55 (47%) Frame = +1 Query: 484 MPTCSIEQERLYVNITLHFQL*RKGKSHLCSIICLHLLGVVRLSLKSQPKCQCEL 648 +P S EQ +L V I L + + LCS I L L + R LK+ P C L Sbjct: 630 LPAISGEQTKLTVLILQDNHLSQSSVTGLCSFISLQYLDLSRNWLKTFPTEVCNL 684 >10_08_0496 - 18328875-18328907,18329056-18329106,18329562-18329690, 18330491-18330524,18331252-18331280,18331801-18332945, 18333003-18333353,18334617-18334893 Length = 682 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 604 VRLSLKSQPKCQCELSPSKDWS 669 V L L QPKC CEL P WS Sbjct: 605 VNLKLIKQPKCTCELGPK--WS 624 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,625,768 Number of Sequences: 37544 Number of extensions: 414278 Number of successful extensions: 862 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -