BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0566 (630 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20585.2 68415.m02406 expressed protein 29 1.9 At2g20585.1 68415.m02405 expressed protein 29 1.9 At1g57770.1 68414.m06554 amine oxidase family contains similarit... 29 1.9 At3g57560.1 68416.m06409 aspartate/glutamate/uridylate kinase fa... 29 3.4 At1g78990.1 68414.m09210 transferase family protein low similari... 29 3.4 At5g38560.1 68418.m04662 protein kinase family protein contains ... 28 5.9 At2g20180.2 68415.m02360 basic helix-loop-helix (bHLH) family pr... 28 5.9 >At2g20585.2 68415.m02406 expressed protein Length = 100 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 141 ASSRTRAPPTFRSTSKVSPCTRPCTRPV 224 AS APP FR+T++ SP P PV Sbjct: 30 ASQAKSAPPLFRATARRSPLLSPLRNPV 57 >At2g20585.1 68415.m02405 expressed protein Length = 100 Score = 29.5 bits (63), Expect = 1.9 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 141 ASSRTRAPPTFRSTSKVSPCTRPCTRPV 224 AS APP FR+T++ SP P PV Sbjct: 30 ASQAKSAPPLFRATARRSPLLSPLRNPV 57 >At1g57770.1 68414.m06554 amine oxidase family contains similarity to carotenoid isomerase [Lycopersicon esculentum] GI:19550437, phytoene dehydrogenase (PDH1) GI:433144 from (Cercospora nicotianae); contains Pfam profile PF01593 amine oxidase, flavin-containing Length = 574 Score = 29.5 bits (63), Expect = 1.9 Identities = 14/21 (66%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = +1 Query: 403 PHAKVVVL-SGAGALCCGATL 462 P A VVV+ SG G LCCGA L Sbjct: 51 PEADVVVIGSGIGGLCCGALL 71 >At3g57560.1 68416.m06409 aspartate/glutamate/uridylate kinase family protein similar to acetylglutamate kinase from Porphyra purpurea [SP|P31595], Campylobacter jejuni [GI:6650364] contains Pfam profile PF00696: Amino acid kinase family Length = 347 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/42 (35%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +2 Query: 23 VTGQITARLNTAEEQVLTSPRGLLPHEVTASSLVK-VDMQGV 145 V G++ A L + +LT G+L ++ SSL+K +D++GV Sbjct: 248 VAGELAAALGAEKLILLTDVAGILENKEDPSSLIKEIDIKGV 289 >At1g78990.1 68414.m09210 transferase family protein low similarity to acetyl CoA: benzylalcohol acetyltransferase Clarkia breweri GI:3170250, GI:6166336, Clarkia concinna GI:6166326, anthranilate N-hydroxycinnamoyl/benzoyltransferase Dianthus caryophyllus GI:2239091; contains Pfam profile PF02458 transferase family Length = 455 Score = 28.7 bits (61), Expect = 3.4 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = -1 Query: 174 GKLVVPWSWTTPCMSTLTRDEAVTSWGSRPRGDVSTCSSAVFRRAVICPVTPVVVQPN 1 G +VV ++ + + + SW R DV FRR+++ P P+V+ P+ Sbjct: 147 GSIVVGCTFDHRVADAYSMNMFLLSWAEISRSDVPISCVPSFRRSLLNPRRPLVMDPS 204 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 27.9 bits (59), Expect = 5.9 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +2 Query: 470 PSCTRVCSPPPPTATEVSSHAVG*PHPAR*LNAETDVRGVPASRP 604 P+ T SPPPP AT S + P+ T + VP +P Sbjct: 163 PTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTPLPVVPREKP 207 >At2g20180.2 68415.m02360 basic helix-loop-helix (bHLH) family protein contains Pfam domain, PF00010: Helix-loop-helix DNA-binding domain Length = 478 Score = 27.9 bits (59), Expect = 5.9 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = -1 Query: 198 TEKPSTLTGKLVV---PWSWTTPCMSTLTRDEAVTSWGSRPRGDVSTCSSAVFRRAVICP 28 T+KPS+ KL+ P + + +++ +TSW P D CS +F A Sbjct: 58 TKKPSSSPPKLLPSMDPQQQPSSDQNLFIQEDEMTSWLHYPLRDDDFCSDLLFSAAPTAT 117 Query: 27 VTPVVVQ 7 T V Q Sbjct: 118 ATATVSQ 124 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,484,629 Number of Sequences: 28952 Number of extensions: 214739 Number of successful extensions: 761 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 757 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1285411824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -