Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0563
         (697 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g58400.1 68414.m06644 disease resistance protein (CC-NBS-LRR ...    29   2.2  

>At1g58400.1 68414.m06644 disease resistance protein (CC-NBS-LRR
           class), putative domain signature CC-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 900

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 2/62 (3%)
 Frame = -1

Query: 433 LCNNIFIYIQQIVSTWNSMLTSHRTQDLWRNATTGSLRNIWFETIFASCI--VYLISYSI 260
           LCN + +   +  ST NS L   R     R  T G  ++I  ET+FAS +   +L + SI
Sbjct: 662 LCNLVNLETLENFSTENSSLEDLRGMVSLRTLTIGLFKHISKETLFASILGMRHLENLSI 721

Query: 259 RS 254
           R+
Sbjct: 722 RT 723


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,104,697
Number of Sequences: 28952
Number of extensions: 310336
Number of successful extensions: 645
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 632
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 645
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1487069504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)