SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0561
         (655 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    22   4.5  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    22   4.5  
AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phospha...    22   4.5  
AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic ac...    21   7.9  

>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +1

Query: 241 YPHHPTTLEHSD 276
           YP+HP+T E S+
Sbjct: 390 YPYHPSTQEDSE 401


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +1

Query: 241 YPHHPTTLEHSD 276
           YP+HP+T E S+
Sbjct: 390 YPYHPSTQEDSE 401


>AF023666-1|AAC14552.1|  363|Apis mellifera sn-glycerol-3-phosphate
           dehydrogenase protein.
          Length = 363

 Score = 22.2 bits (45), Expect = 4.5
 Identities = 11/28 (39%), Positives = 14/28 (50%)
 Frame = +3

Query: 501 SHLAEKAYHEQLSVAEITNACFEPANQM 584
           SH+  K  H  +SV    N   E AN+M
Sbjct: 135 SHIISKQLHIPVSVLMGANLASEVANEM 162


>AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic
           acetylcholine Apisa7-2 subunit protein.
          Length = 461

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 42  ESASSLTSVPVCKDS*SSTPSVEVPALGSLPY*WS 146
           +S SS   V   ++S SS+PS+++   G L   WS
Sbjct: 357 QSQSSPKFVARREESNSSSPSLDLGKEGGLEAQWS 391


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 191,681
Number of Sequences: 438
Number of extensions: 4245
Number of successful extensions: 8
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19804986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -