BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0559 (611 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 23 1.8 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 1.8 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.4 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 22 5.4 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 7.2 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.5 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 9.5 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 515 YDRRVQREHGLDGDVHGG 462 Y +RV ++G+ GD +GG Sbjct: 60 YKQRVYDKNGMTGDAYGG 77 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.4 bits (48), Expect = 1.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 443 VRNIQHARHVRRHPSRALAVRVGRTTGIVL 532 ++ IQ H H + + +R+G TG+VL Sbjct: 564 LKMIQACSHHLTHKGKPIRMRIGIHTGMVL 593 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 354 LRVAPEEHPVLLTEAPLNPKANREKM 431 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -3 Query: 261 LFSLCLISYIRV 226 LF+LC++SY+ V Sbjct: 8 LFTLCIVSYMMV 19 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 7.2 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 118 GMCKAGFAGD 147 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 177 DRGEHGARSIISCETGLA 124 D GEH ++ E GLA Sbjct: 130 DPGEHNGDTVTDVEAGLA 147 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 9.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 Query: 177 DRGEHGARSIISCETGLA 124 D GEH ++ E GLA Sbjct: 125 DPGEHNGDTVTDVEAGLA 142 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,267 Number of Sequences: 438 Number of extensions: 5056 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18093444 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -