BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0558 (636 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0780 + 6047375-6047494,6047603-6047713,6047804-6047926,604... 29 3.1 08_02_1350 - 26312275-26313613,26314833-26315110 27 9.4 >07_01_0780 + 6047375-6047494,6047603-6047713,6047804-6047926, 6048035-6048168,6048273-6049551 Length = 588 Score = 29.1 bits (62), Expect = 3.1 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +3 Query: 267 KILEDDCYRAYIASVESSILKDPKFFWRFVKTNKGSANNLPSTLT 401 K++EDDC + Y+A L P W T G + S T Sbjct: 4 KMIEDDCEKVYVAISPIQSLCPPMLLWTLRNTPPGKTYSCCSAQT 48 >08_02_1350 - 26312275-26313613,26314833-26315110 Length = 538 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +1 Query: 382 TFLLLSHTKDKQLTLGTLSVIFFVNTSN 465 T LLL HTK K LT+G VI + T N Sbjct: 138 TVLLLGHTKRKDLTIGEGKVI--ITTDN 163 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,684,434 Number of Sequences: 37544 Number of extensions: 266969 Number of successful extensions: 545 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1561213104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -