BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0558 (636 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB209869-1|BAD93106.1| 1006|Homo sapiens endoplasmic reticulum t... 30 7.9 >AB209869-1|BAD93106.1| 1006|Homo sapiens endoplasmic reticulum to nucleus signalling 1 isoform 1 variant protein. Length = 1006 Score = 29.9 bits (64), Expect = 7.9 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 4/38 (10%) Frame = -3 Query: 427 PESVVCPSYVRVEGRLFALP----LLVLTNLQKNLGSF 326 P V+CP R +GR+ A+P LL+LT L LG F Sbjct: 12 PRPVLCPYRPRSQGRVLAMPARRLLLLLTLLLPGLGIF 49 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,563,489 Number of Sequences: 237096 Number of extensions: 1550597 Number of successful extensions: 2485 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2485 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6972732040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -