BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0554 (628 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 33 0.14 SB_18929| Best HMM Match : BRCT (HMM E-Value=1.4e-08) 33 0.25 SB_32468| Best HMM Match : Drf_FH1 (HMM E-Value=2.6) 29 2.3 SB_55929| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_8479| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_20998| Best HMM Match : Extensin_2 (HMM E-Value=0.002) 28 5.4 SB_5193| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_42339| Best HMM Match : LIM (HMM E-Value=8.9) 28 7.1 SB_18769| Best HMM Match : LIM (HMM E-Value=8.9) 28 7.1 SB_16478| Best HMM Match : C2 (HMM E-Value=2.2e-13) 27 9.4 SB_21812| Best HMM Match : GRASP55_65 (HMM E-Value=2.3) 27 9.4 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 33.5 bits (73), Expect = 0.14 Identities = 19/50 (38%), Positives = 28/50 (56%) Frame = +2 Query: 47 PTIGRTYVYDNKYYKNLGCLIKNAKRKKHLVEHEQEEKQWDLLDNYMVAE 196 PT RT+ D+K ++ L+K K + + +E E K+W L NYM AE Sbjct: 87 PTFARTFAVDSKVTPSVIALLKQFKWEIVAIIYE-EWKKWVQLKNYMKAE 135 >SB_18929| Best HMM Match : BRCT (HMM E-Value=1.4e-08) Length = 1213 Score = 32.7 bits (71), Expect = 0.25 Identities = 25/90 (27%), Positives = 40/90 (44%) Frame = +1 Query: 139 RT*TRGEAMGSSRQLHGCRRSLFRTGQKPKTYPF*RNSHVKPDTMKLIVNWSGKEFLRET 318 R+ T G S+Q+ ++F+ G+K R +K + V W E RET Sbjct: 123 RSNTENRFDGISKQMELLGATIFKDGKKAT-----REKALKKGIHLVTVLWV--ESCRET 175 Query: 319 WTRFVEDSFPIVNDQEVMDVYLVANLKPTR 408 R E+ FP++ E+ L+ LK T+ Sbjct: 176 GKRVAEELFPVIAQDELSTPLLMGKLKRTK 205 >SB_32468| Best HMM Match : Drf_FH1 (HMM E-Value=2.6) Length = 416 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -3 Query: 218 CPVLKRDLRQPCSCLEDPIASPLVHVRLGASCAWRF**DSPSFCNIYC 75 CP + R + PC ++ P++ P +V S + + S C YC Sbjct: 71 CPYVNRTVSVPCPYVKRPVSVPCPYVNRAVSVPCPYVNRAVSVCQPYC 118 >SB_55929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 28.7 bits (61), Expect = 4.1 Identities = 27/101 (26%), Positives = 42/101 (41%) Frame = -2 Query: 510 CHVGWLHNSDYFVGHVVFFPPKSVLSEELVAPVGACGFEVGDEVHVHHLLVVYNGEAVLN 331 CH G L + + P S S +++ +G C F G + + V G Sbjct: 448 CHAGCLTQINGSLAECSCLLPSS--SRDIIT-MGKCRFSCGYKYGILLGAVFLFGFFTFM 504 Query: 330 KTGPSFTQKLFAAPVDD*LHGIGFHMRISLKRVSFWFLPGP 208 P+ T L PVD +G+GF M ++ R+ +PGP Sbjct: 505 NMTPATTVTLRCLPVDRRTYGLGFQM--TMTRL-LGAIPGP 542 >SB_8479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +2 Query: 380 TSSPTSNPHAPTGATSSSLNTLLGGKKTT--CPTK 478 T S T P PT + +SS + GG KTT C T+ Sbjct: 353 TGSRTRTPPTPTSSRASSRGSARGGAKTTKKCTTR 387 >SB_20998| Best HMM Match : Extensin_2 (HMM E-Value=0.002) Length = 765 Score = 28.3 bits (60), Expect = 5.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 389 PTSNPHAPTGATSSSLNTLLGGKKTTCPT 475 P S H+P +T S+NT+L + CP+ Sbjct: 703 PVSRYHSPRPSTCLSINTILHDQARACPS 731 >SB_5193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 672 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/58 (25%), Positives = 31/58 (53%) Frame = +1 Query: 358 DQEVMDVYLVANLKPTRPNRCYKFLAQHALRWEEDYVPHEVIRIVEPSYVA*TTNTEL 531 D ++DV + KPT+ +C F + H+L ++ +V E +R++ + + TE+ Sbjct: 553 DSNILDVR--THFKPTKTFQCTHFSSCHSLSNKKGFVKGEGLRLLRTNSALASFKTEI 608 >SB_42339| Best HMM Match : LIM (HMM E-Value=8.9) Length = 279 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 74 DNKYYKNLGCLIKNAKRKKHL-VEHEQEEKQWDLLDNY 184 D N C+ K + +HL VE++Q +K W DN+ Sbjct: 168 DKTVDSNKCCICKEIQNLQHLFVEYKQVKKFWSAFDNW 205 >SB_18769| Best HMM Match : LIM (HMM E-Value=8.9) Length = 279 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 74 DNKYYKNLGCLIKNAKRKKHL-VEHEQEEKQWDLLDNY 184 D N C+ K + +HL VE++Q +K W DN+ Sbjct: 168 DKTVDSNKCCICKEIQNLQHLFVEYKQVKKFWSAFDNW 205 >SB_16478| Best HMM Match : C2 (HMM E-Value=2.2e-13) Length = 186 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = +1 Query: 274 KLIVNWSGKEFLRETWTRFVEDSFPIVNDQEVMDVYLVANLKPTRPNRCYKFLA 435 ++++ S ++ RE W + PI + + + +L PTRPNR K +A Sbjct: 115 RVVLGTSAEDLEREHWNEAMTAKKPIARWHSLREFH--NSLLPTRPNRTSKPIA 166 >SB_21812| Best HMM Match : GRASP55_65 (HMM E-Value=2.3) Length = 660 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 386 SPTSNPHAPTGATSSSLNTLLGGKKTTCPTK 478 S T P PT + +SS + GG KTT TK Sbjct: 578 SRTRTPPTPTSSRASSRGSAGGGAKTTKTTK 608 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,616,127 Number of Sequences: 59808 Number of extensions: 469013 Number of successful extensions: 1580 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1579 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -