BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0554 (628 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g09350.1 68414.m01046 galactinol synthase, putative contains ... 29 2.5 At1g56600.1 68414.m06509 galactinol synthase, putative similar t... 29 3.3 At1g60470.1 68414.m06808 galactinol synthase, putative similar t... 28 4.4 At2g12130.1 68415.m01306 hypothetical protein 28 5.8 At1g43245.1 68414.m04985 expressed protein 28 5.8 >At1g09350.1 68414.m01046 galactinol synthase, putative contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 334 Score = 29.1 bits (62), Expect = 2.5 Identities = 16/56 (28%), Positives = 20/56 (35%) Frame = -2 Query: 516 CSCHVGWLHNSDYFVGHVVFFPPKSVLSEELVAPVGACGFEVGDEVHVHHLLVVYN 349 C C W H Y +G+ P K E + P F G V+ L YN Sbjct: 139 CFCEKTWSHTPQYKIGYCQQCPDKVTWPESELGPKPPLYFNAGMFVYEPSLPTYYN 194 >At1g56600.1 68414.m06509 galactinol synthase, putative similar to galactinol synthase, isoform GolS-1 GI:5608497 from [Ajuga reptans] Length = 335 Score = 28.7 bits (61), Expect = 3.3 Identities = 15/56 (26%), Positives = 22/56 (39%) Frame = -2 Query: 516 CSCHVGWLHNSDYFVGHVVFFPPKSVLSEELVAPVGACGFEVGDEVHVHHLLVVYN 349 C C W H+ Y +G+ P K E + P F G V+ +L +N Sbjct: 145 CFCEKTWSHSPQYKIGYCQQCPDKVTWPEAKLGPKPPLYFNAGMFVYEPNLSTYHN 200 >At1g60470.1 68414.m06808 galactinol synthase, putative similar to galactinol synthase GI:5608497 from [Ajuga reptans] Length = 334 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = -2 Query: 516 CSCHVGWLHNSDYFVGHVVFFPPKSVLSEELVAPVGACGFEVG 388 C C W H+ Y +G+ P K E++ +P F G Sbjct: 146 CFCEKTWSHSLQYSIGYCQQCPEKVTWPEDMESPPPPLYFNAG 188 >At2g12130.1 68415.m01306 hypothetical protein Length = 209 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 406 VWV*GWRRGTRPSPLGRLQWGSCPQQNGSKFHAKTLC 296 +W WR P LGR +G+C + ++A+ LC Sbjct: 170 LWNRSWRFVVSPDCLGRCSYGACCRNCFFYWYARELC 206 >At1g43245.1 68414.m04985 expressed protein Length = 558 Score = 27.9 bits (59), Expect = 5.8 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +1 Query: 361 QEVMDVYLVANLKPTRPNRCYKFLAQHALRWEEDYVPHEVIRIVEPSYVA 510 QE +D +L N+ P + + H ++++ED PH +R+ YVA Sbjct: 321 QEAIDDFLSDNIDPKTCCEMIESVLHHGIQFKEDSQPH-CLRLHACHYVA 369 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,946,768 Number of Sequences: 28952 Number of extensions: 327517 Number of successful extensions: 987 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -