BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0553 (391 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 2.9 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 2.9 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.8 bits (44), Expect = 2.9 Identities = 12/51 (23%), Positives = 23/51 (45%) Frame = +2 Query: 137 IIYSKKHSLKHTDSMYRYYPFSLYFTYTINLDTSVYYCIYMFKVFSVHICV 289 II S + H ++ Y+Y + Y N + +YY Y+ + + + V Sbjct: 81 IISSLSNKTIHNNNNYKYNYNNKYNYNNNNYNKKLYYKNYIINIEQIPVPV 131 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 2.9 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +2 Query: 128 FNSIIYSKKHSLKHTDSMYRYYPFSLYFTYTINLDT 235 F ++Y ++S + +YP+ Y T+ I DT Sbjct: 206 FALLVYDFRNSRSWRITNNLFYPYPPYGTFNIKGDT 241 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,659 Number of Sequences: 438 Number of extensions: 1823 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9514659 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -