BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0551 (647 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 25 7.1 SPCC1795.08c |||histone acetyltransferase complex subunit |Schiz... 25 9.4 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 25.4 bits (53), Expect = 7.1 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +2 Query: 296 PRANPGPVLFPPSPAGDPSQTSGVVVGASGYGFVPPGSQ 412 P + P P PP PAG PS + +S PG + Sbjct: 1711 PMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNPGDR 1749 >SPCC1795.08c |||histone acetyltransferase complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 985 Score = 25.0 bits (52), Expect = 9.4 Identities = 10/21 (47%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = +1 Query: 346 PLADKRSGGRCFRIWVRA-PR 405 PLA+KR+ CF W++ PR Sbjct: 746 PLAEKRTAWDCFERWIQVDPR 766 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,774,583 Number of Sequences: 5004 Number of extensions: 59172 Number of successful extensions: 169 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 169 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -