BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0550 (618 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43241| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_43241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2022 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +3 Query: 411 SCRVKYSFSLDFYIQR*QNPRI*YCHTL--CQTVIFETRIK 527 SC +K+SFS D +IQR Q TL C+T + E R K Sbjct: 1689 SCVLKFSFSTDEHIQRIQTEMAPLKQTLRECETTLREARDK 1729 >SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3293 Score = 27.5 bits (58), Expect = 9.2 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 394 ALKSSSVAGLNIHSALIFIFRDNKIRASNIAIHYAR 501 ++ S + GL+IH A + + + R S ++IH+AR Sbjct: 1701 SIHRSRLVGLSIHHARLSVLSIHHARLSVLSIHHAR 1736 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,685,845 Number of Sequences: 59808 Number of extensions: 291757 Number of successful extensions: 583 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -