BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0548 (639 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 25 1.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 2.7 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 25.4 bits (53), Expect = 1.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 378 IALISCLKFIMQHSINYSAIFSDCSSAIQAISKNP 482 +A++SCL +Q INY S C + Q + NP Sbjct: 7 VAIVSCLVSGLQAQINYCTT-SYCRNGRQNVGCNP 40 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.6 bits (51), Expect = 2.7 Identities = 10/39 (25%), Positives = 23/39 (58%) Frame = +1 Query: 31 NSREQPCLIKSVNYIDSFQSPLIQSDTLPIFKISFKALC 147 +++ + CL+K + D + S + + P+ ++S KA+C Sbjct: 598 DAKIERCLMKDESCPDGYYSDYVLQEEGPLKQLSGKAVC 636 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 714,787 Number of Sequences: 2352 Number of extensions: 15017 Number of successful extensions: 40 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -