BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0548 (639 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41994-3|AAO91712.1| 251|Caenorhabditis elegans Rnase h protein... 27 8.6 >U41994-3|AAO91712.1| 251|Caenorhabditis elegans Rnase h protein 1.0, isoform c protein. Length = 251 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 545 QNNIKVEIVWIPSHTGILGNETVDQMGLKEA 637 + +KV+ + + H GI GNE D++ K A Sbjct: 214 RQKLKVKFLHVRGHAGIDGNEKADELARKGA 244 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,518,924 Number of Sequences: 27780 Number of extensions: 335765 Number of successful extensions: 760 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -