BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0546 (591 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C7.09c |uve1|uvde|endonuclease Uve1 |Schizosaccharomyces p... 30 0.22 SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces ... 27 2.7 SPBC14C8.03 |fma2||methionine aminopeptidase Fma2 |Schizosacchar... 26 3.6 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 26 4.7 SPCC737.02c |qcr7||ubiquinol-cytochrome-c reductase complex subu... 25 6.2 SPBC6B1.04 |mde4||monopolin-like complex subunit Mde4|Schizosacc... 25 6.2 >SPBC19C7.09c |uve1|uvde|endonuclease Uve1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 599 Score = 30.3 bits (65), Expect = 0.22 Identities = 21/75 (28%), Positives = 37/75 (49%) Frame = +2 Query: 128 FLEHIFATSLRPDSMSSLINPIKPEQPLKAMNDEIGEKKRGKNSKQYLALEPKSKVNECA 307 ++E + SL+ +S S P+ PEQ + I +++R ++S + L E +++ A Sbjct: 177 YVEEVDEKSLKNESSSDEFEPVVPEQ----LETPISKRRRSRSSAKNLEKESTMNLDDHA 232 Query: 308 FRCSKVSLTKRIPGR 352 R L K IP R Sbjct: 233 PREMFDCLDKPIPWR 247 >SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces pombe|chr 1|||Manual Length = 1888 Score = 26.6 bits (56), Expect = 2.7 Identities = 19/62 (30%), Positives = 27/62 (43%) Frame = -2 Query: 407 FWCIVISVFGVFVSTHKEVVQVCVLLMILCCSEKRIH*LLTLVRELGIVLNFYLFFFLLS 228 FW ++I V HK+ V V+ L RIH L++ R + +L F S Sbjct: 942 FWPLIIRVSESAFKMHKDGHNVKVVERYLRTVFLRIHFLISEWRWEDVAQILFLIFDFFS 1001 Query: 227 HR 222 HR Sbjct: 1002 HR 1003 >SPBC14C8.03 |fma2||methionine aminopeptidase Fma2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 426 Score = 26.2 bits (55), Expect = 3.6 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +2 Query: 215 AMNDEIGEKKRGKNSKQYLALEPKSKVNECAFRCSKVSLTKRIPGRPLCE 364 A N E +KK+ K+SK+ P+ + N SK+ + K+ P +C+ Sbjct: 42 ASNGEKKKKKKKKSSKKKKT--PQEQTNPPTVGLSKIFVNKKYPVGEVCD 89 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 25.8 bits (54), Expect = 4.7 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 155 LRPDSMSSLINPIKPEQPLKAMNDEIGEKKRGKNSKQYL 271 L P S + ++P+ E L+AM K RGK SK+Y+ Sbjct: 1953 LPPASNNRKVDPL--EDILQAMPPPTTRKARGKTSKRYV 1989 >SPCC737.02c |qcr7||ubiquinol-cytochrome-c reductase complex subunit 6|Schizosaccharomyces pombe|chr 3|||Manual Length = 137 Score = 25.4 bits (53), Expect = 6.2 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = +3 Query: 300 NALFAAAKYH*QNAYLDDLFVSAHEDTKYRYYNAPKKKKFFLVYFIKTVLLL 455 NA + Y DDL + ++DT+ PK + + VY I+ + L Sbjct: 25 NAYVHLSGYRKYGLRYDDLMLEENDDTQKALSRLPKMESYDRVYRIRRAMQL 76 >SPBC6B1.04 |mde4||monopolin-like complex subunit Mde4|Schizosaccharomyces pombe|chr 2|||Manual Length = 421 Score = 25.4 bits (53), Expect = 6.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 206 PLKAMNDEIGEKKRGKNSKQ 265 PLK NDEI E K+G K+ Sbjct: 402 PLKKRNDEINELKKGFTMKK 421 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,249,124 Number of Sequences: 5004 Number of extensions: 43748 Number of successful extensions: 126 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 256184654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -