BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0546 (591 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0932 - 32841331-32842242 30 1.6 02_01_0141 + 1017654-1017745,1018332-1018389,1018485-1018595,101... 29 2.1 >02_05_0932 - 32841331-32842242 Length = 303 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = +2 Query: 155 LRPDSMSSLI-NPIKPEQPLKAMNDEIGEKKRGKNSKQYLALEPKSKVNECAFRCSKVSL 331 +RPD SL+ P +P P+ ++ EKKRG+ + A A C++ S Sbjct: 85 VRPDPQPSLLLPPPQPPPPMPESTGDVAEKKRGRRKNKNGAKSAPFACLLNALLCNRRSA 144 Query: 332 TKRIPGRP 355 P P Sbjct: 145 RSAEPTTP 152 >02_01_0141 + 1017654-1017745,1018332-1018389,1018485-1018595, 1018853-1018990,1019559-1019628,1019711-1019766, 1020203-1020328,1020648-1020787,1020932-1021004, 1021095-1021169,1021277-1021591 Length = 417 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -3 Query: 556 IPRVLMINWVPHMWILIQNGVEEAFVQY 473 I R L ++ PHMW+ + +G+E F+ Y Sbjct: 196 IMRELSKSFKPHMWVNVHSGMEALFMPY 223 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,428,955 Number of Sequences: 37544 Number of extensions: 242557 Number of successful extensions: 560 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 560 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1400060088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -