BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0543 (628 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g42050.1 68416.m04311 vacuolar ATP synthase subunit H family ... 28 5.8 At2g41530.1 68415.m05132 esterase, putative similar to SP|P10768... 27 7.7 >At3g42050.1 68416.m04311 vacuolar ATP synthase subunit H family protein identical to probable vacuolar ATP synthase subunit H (EC 3.6.3.14)(V-ATPase H subunit) (Vacuolar proton pump H subunit) (Vacuolar proton pump subunit SFD) SP:Q9LX65 from [Arabidopsis thaliana]; contains Pfam PF03224: V-ATPase subunit H Length = 441 Score = 27.9 bits (59), Expect = 5.8 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = -1 Query: 385 VDVLCSLIEIQINSSSYLQLVAIMVCIYCVNFNSNSIEYIIRSVTFKLLYFEVKH 221 V +L LI S L +CI+ +++ +IEY+ S T + L VKH Sbjct: 198 VKLLVPLISPASTQQSIQLLYETCLCIWLLSYYEPAIEYLATSRTMQRLTEVVKH 252 >At2g41530.1 68415.m05132 esterase, putative similar to SP|P10768 Esterase D (EC 3.1.1.1) {Homo sapiens}; contains Pfam profile: PF00756 putative esterase Length = 284 Score = 27.5 bits (58), Expect = 7.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 210 FERICFTSKYNNLKVTLLI 266 ++ C SKYNNL T+LI Sbjct: 205 YDATCLISKYNNLSATILI 223 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,309,493 Number of Sequences: 28952 Number of extensions: 238576 Number of successful extensions: 514 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 506 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -