BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0542 (558 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 9.5 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 9.5 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 9.5 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 20.6 bits (41), Expect = 9.5 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -1 Query: 549 PLRGPQCFLYYFRLFEVEHGRVRGSCALSRH 457 PLR + RL E G ++ C LS H Sbjct: 234 PLRKATAKIAAKRLIEDFSGYIKPKCVLSDH 264 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 20.6 bits (41), Expect = 9.5 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -1 Query: 345 NPTILMRIWTR 313 N T+L+ +WTR Sbjct: 53 NSTVLLALWTR 63 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 417 PGARSAP*SDHERASMLQQAMLG 349 PGA S P +D+ Q ++LG Sbjct: 121 PGATSQPPTDNSHVHHHQTSLLG 143 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,502 Number of Sequences: 336 Number of extensions: 2611 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13681771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -