BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0542 (558 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0570 - 18614227-18614574,18614729-18614842,18614933-186151... 31 0.62 07_03_0103 - 13425411-13425713,13425874-13425974,13426410-134264... 28 5.8 03_05_0916 - 28762214-28762414,28763144-28763242,28763573-287639... 27 7.7 >09_04_0570 - 18614227-18614574,18614729-18614842,18614933-18615130, 18615290-18615463,18615546-18615752,18615886-18616180, 18616269-18617275 Length = 780 Score = 31.1 bits (67), Expect = 0.62 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +2 Query: 194 IRSGQGQCGVLPISIKLVRKPCFCVLFVILAYALNAQNAKRV 319 +R+G +CG LP+ KLV + C L V + A+ ++A V Sbjct: 487 LRAGGHECGCLPVLAKLVMEHCVARLDVAMFNAVLRESANEV 528 >07_03_0103 - 13425411-13425713,13425874-13425974,13426410-13426471, 13426951-13427123 Length = 212 Score = 27.9 bits (59), Expect = 5.8 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +1 Query: 409 RARTYIRDSGGVMAARVSAEGAGPSY 486 RA +++ GG A R SA GAGP Y Sbjct: 11 RATPHLQTLGGGAARRQSAAGAGPCY 36 >03_05_0916 - 28762214-28762414,28763144-28763242,28763573-28763998, 28764259-28764501,28764706-28764927,28765392-28765721, 28767380-28767800,28768292-28768404,28769224-28769367, 28769439-28769570,28769802-28770013,28770983-28771505 Length = 1021 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 418 SGRALRAVKRSRARIHASTGHVGG 347 +GR L A K RI+AS GH GG Sbjct: 26 AGRLLVAGKDGSLRIYASPGHAGG 49 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,138,905 Number of Sequences: 37544 Number of extensions: 303440 Number of successful extensions: 748 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 748 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1269546012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -