BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0542 (558 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 1.3 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 23 9.0 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.4 bits (53), Expect = 1.3 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 142 LNKAHEWNLSIESAVCGEKHV*KRQITIEPYFVH 41 L+K E ++ +CGEK KR++ Y VH Sbjct: 545 LSKRREEDVCASWPLCGEKSAKKRKLPSRWYLVH 578 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 22.6 bits (46), Expect = 9.0 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -1 Query: 225 STPH*PWPDRIYIKKIHFRRPIL 157 + P P+ DRI+I+ ++RP L Sbjct: 199 AAPREPFTDRIWIRLSAYQRPSL 221 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 587,968 Number of Sequences: 2352 Number of extensions: 10854 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -