BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0537 (595 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB10D8.01 |||cysteine transporter |Schizosaccharomyces pombe|... 26 3.6 SPAC18G6.10 |||chromosome segregation protein |Schizosaccharomyc... 25 8.3 >SPBPB10D8.01 |||cysteine transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 552 Score = 26.2 bits (55), Expect = 3.6 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 505 FYSISCQGCNIP 540 F+ ISC GCNIP Sbjct: 217 FFYISCYGCNIP 228 >SPAC18G6.10 |||chromosome segregation protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 688 Score = 25.0 bits (52), Expect = 8.3 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 4/84 (4%) Frame = +1 Query: 292 RISHDL*YSHYRILDELNR-RKYSCVSLKSRDH*FCTRIR*MYGLRLTLIKFR-YHHKIC 465 ++ HD+ Y++YR+L L S +S H F + + + L L++ + + C Sbjct: 289 KVFHDIKYANYRLLHNLRAFPGISAISSSYLVHIFMILLGVVAAIFLALLREKMFTAGFC 348 Query: 466 DDETSHSKRD--SIAFYSISCQGC 531 D S S I+F S+ C+ C Sbjct: 349 DSGASGSSASILGISFPSL-CRTC 371 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,322,736 Number of Sequences: 5004 Number of extensions: 44576 Number of successful extensions: 86 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 258201856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -