BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0534 (280 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0438 - 5723451-5723759,5723795-5723863,5724025-5724210,572... 26 3.7 12_01_0782 + 7163238-7163305,7164178-7164262 25 6.5 03_01_0259 - 1996427-1998772 25 6.5 >04_01_0438 - 5723451-5723759,5723795-5723863,5724025-5724210, 5724297-5724558,5724662-5724960,5725040-5725453, 5725533-5725899,5726002-5726146,5726562-5727558 Length = 1015 Score = 26.2 bits (55), Expect = 3.7 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +2 Query: 71 WLLCTSPVTPHM*GPYVQAGYXXXXXXXXXXSRTPLGY 184 WLL T V H P+ + GY +RT + Y Sbjct: 764 WLLATEEVVDHAGEPHTEEGYEAYLRWYQPRTRTRVTY 801 >12_01_0782 + 7163238-7163305,7164178-7164262 Length = 50 Score = 25.4 bits (53), Expect = 6.5 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 Query: 276 RRGGGTYRAYSQDVL 232 RRGGG Y +Y +D+L Sbjct: 8 RRGGGDYDSYHRDIL 22 >03_01_0259 - 1996427-1998772 Length = 781 Score = 25.4 bits (53), Expect = 6.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 45 IFNNAHENVGCYVLHQSHLTCEGR 116 IF H+N GCY++ S GR Sbjct: 606 IFQLEHDNTGCYIVLSSMYADAGR 629 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,435,130 Number of Sequences: 37544 Number of extensions: 112761 Number of successful extensions: 150 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 14,793,348 effective HSP length: 70 effective length of database: 12,165,268 effective search space used: 267635896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -