BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0534 (280 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7201| Best HMM Match : ketoacyl-synt (HMM E-Value=0) 25 9.4 SB_3121| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.4 >SB_7201| Best HMM Match : ketoacyl-synt (HMM E-Value=0) Length = 1821 Score = 25.0 bits (52), Expect = 9.4 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 Query: 200 LDYSCHTPKASVN 162 +D SCH PKA +N Sbjct: 1213 VDLSCHVPKAEIN 1225 >SB_3121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 789 Score = 25.0 bits (52), Expect = 9.4 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 1 RGDADSPVYHAGTFEYLTMLMKTLAAMYFTSHTSHVRAV 117 R AD + G + L +L L A Y +HT RA+ Sbjct: 715 RDSADHKIADKGYWTTLRILGSALLATYRVAHTGTTRAI 753 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,512,446 Number of Sequences: 59808 Number of extensions: 134288 Number of successful extensions: 253 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 251 length of database: 16,821,457 effective HSP length: 69 effective length of database: 12,694,705 effective search space used: 291978215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -