BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0533 (654 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value S47168-2|AAB23866.2| 919|Caenorhabditis elegans UNC-5 protein. 28 6.7 S47168-1|AAB23867.2| 947|Caenorhabditis elegans UNC-5 protein. 28 6.7 AF036698-5|AAB88356.2| 567|Caenorhabditis elegans Uncoordinated... 28 6.7 AF036698-4|AAB88355.1| 919|Caenorhabditis elegans Uncoordinated... 28 6.7 >S47168-2|AAB23866.2| 919|Caenorhabditis elegans UNC-5 protein. Length = 919 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 7 CCIDGWTSSQPTWC*VVTEAHRHLQRKCRHPP 102 C +DG SS W + HR+ R C PP Sbjct: 271 CKLDGGWSSWSDWSACSSSCHRYRTRACTVPP 302 >S47168-1|AAB23867.2| 947|Caenorhabditis elegans UNC-5 protein. Length = 947 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 7 CCIDGWTSSQPTWC*VVTEAHRHLQRKCRHPP 102 C +DG SS W + HR+ R C PP Sbjct: 299 CKLDGGWSSWSDWSACSSSCHRYRTRACTVPP 330 >AF036698-5|AAB88356.2| 567|Caenorhabditis elegans Uncoordinated protein 5, isoform b protein. Length = 567 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 7 CCIDGWTSSQPTWC*VVTEAHRHLQRKCRHPP 102 C +DG SS W + HR+ R C PP Sbjct: 271 CKLDGGWSSWSDWSACSSSCHRYRTRACTVPP 302 >AF036698-4|AAB88355.1| 919|Caenorhabditis elegans Uncoordinated protein 5, isoform a protein. Length = 919 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 7 CCIDGWTSSQPTWC*VVTEAHRHLQRKCRHPP 102 C +DG SS W + HR+ R C PP Sbjct: 271 CKLDGGWSSWSDWSACSSSCHRYRTRACTVPP 302 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,063,761 Number of Sequences: 27780 Number of extensions: 295538 Number of successful extensions: 662 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -