BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0533 (654 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 3.4 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 4.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 7.9 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +1 Query: 568 KRGLHLHLSPNSRTNIEGSSS 630 ++GL LH +P+ R + G+S+ Sbjct: 28 RKGLRLHDNPSLREGLAGAST 48 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 Query: 217 GLTRGPTTSKVFYYRLRHYEV 279 G+ GP T+ V R HY++ Sbjct: 897 GINHGPVTAGVIGARKPHYDI 917 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 136 QRLPHP*NRNALL-LHGRNRQGGGTYPCGLTR 228 ++LP ++ LL L+G NR+ G Y C + R Sbjct: 372 RQLPGTGRQSELLRLNGINREDRGMYQCIVRR 403 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 7.9 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +1 Query: 136 QRLPHP*NRNALL-LHGRNRQGGGTYPCGLTR 228 ++LP ++ LL L+G NR+ G Y C + R Sbjct: 372 RQLPGTGRQSELLRLNGINREDRGMYQCIVRR 403 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,086 Number of Sequences: 438 Number of extensions: 3722 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -