BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0523 (595 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF494106-1|AAM96012.1| 331|Homo sapiens mutant globoside syntha... 30 7.1 AF494105-1|AAM96011.1| 331|Homo sapiens mutant globoside syntha... 30 7.1 >AF494106-1|AAM96012.1| 331|Homo sapiens mutant globoside synthase protein. Length = 331 Score = 29.9 bits (64), Expect = 7.1 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 7/64 (10%) Frame = +3 Query: 351 MLSTTLCVQIHSLYLLI*PRLLVEHYIHICVQTIS-------DTNLKFIYQIHIPSKPCK 509 ++S L +I+ + + P + Y+ IC+ + DTNL F+Y+IH+ C+ Sbjct: 244 IMSRDLVPRIYEMMGHVKPIKFADVYVGICLNLLKVNIHIPEDTNLFFLYRIHL--DVCQ 301 Query: 510 LRRL 521 LRR+ Sbjct: 302 LRRV 305 >AF494105-1|AAM96011.1| 331|Homo sapiens mutant globoside synthase protein. Length = 331 Score = 29.9 bits (64), Expect = 7.1 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 7/64 (10%) Frame = +3 Query: 351 MLSTTLCVQIHSLYLLI*PRLLVEHYIHICVQTIS-------DTNLKFIYQIHIPSKPCK 509 ++S L +I+ + + P + Y+ IC+ + DTNL F+Y+IH+ C+ Sbjct: 244 IMSRDLVPRIYEMMGHVKPIKFEDVYVRICLNLLKVNIHIPEDTNLFFLYRIHL--DVCQ 301 Query: 510 LRRL 521 LRR+ Sbjct: 302 LRRV 305 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,039,994 Number of Sequences: 237096 Number of extensions: 1224096 Number of successful extensions: 2717 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2716 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6268037466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -