BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0523 (595 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68753-3|CAA92988.3| 984|Caenorhabditis elegans Hypothetical pr... 28 4.4 U97196-7|AAB52462.1| 141|Caenorhabditis elegans Hypothetical pr... 27 7.6 >Z68753-3|CAA92988.3| 984|Caenorhabditis elegans Hypothetical protein ZC518.2 protein. Length = 984 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +1 Query: 244 RPPAVTRCRVPTAASPTVEYDALAAPRVLACGTRPPCCRQR 366 RP + P A +PT Y APR A PP +Q+ Sbjct: 160 RPAPFPAAQPPPAPTPTPSYQQQMAPRPQAPAAYPPASQQQ 200 >U97196-7|AAB52462.1| 141|Caenorhabditis elegans Hypothetical protein B0207.8 protein. Length = 141 Score = 27.5 bits (58), Expect = 7.6 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 143 KFFNAFTEKTQEFINFKLLQYTVNQ 69 KF N F E T +F+NF+ + + N+ Sbjct: 98 KFKNGFCENTMKFVNFQNINRSTNE 122 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,384,383 Number of Sequences: 27780 Number of extensions: 204006 Number of successful extensions: 451 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 451 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1258229602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -