BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0523 (595 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 5.2 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 9.1 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 5.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 396 ASTNYVSEHKALSTTWRPRPAS 331 +S Y+S ST+ PRPAS Sbjct: 825 SSPRYLSAAATSSTSTSPRPAS 846 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/34 (26%), Positives = 15/34 (44%) Frame = -2 Query: 396 ASTNYVSEHKALSTTWRPRPASKYPRSGERVILD 295 ++ NY EHK W+P + V+L+ Sbjct: 184 SNENYNWEHKETHIDWQPEDEECTEATAGAVVLE 217 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,334 Number of Sequences: 438 Number of extensions: 2417 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -