BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0522 (475 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyce... 26 3.4 SPBC354.02c |sec61||translocon alpha subunit Sec61|Schizosacchar... 25 4.5 >SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2100 Score = 25.8 bits (54), Expect = 3.4 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -3 Query: 104 YVRCCFPYLFRPLQNTVR-LLITSQI 30 Y CCF YLF+ N + LLI Q+ Sbjct: 1998 YASCCFLYLFKSSSNNPQELLIKEQM 2023 >SPBC354.02c |sec61||translocon alpha subunit Sec61|Schizosaccharomyces pombe|chr 2|||Manual Length = 479 Score = 25.4 bits (53), Expect = 4.5 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -1 Query: 442 SAARYSYTPVTNTLPPVFDPVFN--YY*FVQFSCAIFKKI 329 S Y +P + + DP+ Y F F+CA+F K+ Sbjct: 339 SGLSYYLSPPASFQDALIDPIHTLVYVFFTMFACALFSKL 378 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,806,330 Number of Sequences: 5004 Number of extensions: 35299 Number of successful extensions: 79 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 182448900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -