BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0522 (475 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24160.1 68418.m02842 squalene monooxygenase 1,2 / squalene e... 28 3.7 At5g24150.1 68418.m02839 squalene monooxygenase 1,1 / squalene e... 27 4.9 >At5g24160.1 68418.m02842 squalene monooxygenase 1,2 / squalene epoxidase 1,2 (SQP1,2) identical to SP|O65402 Length = 517 Score = 27.9 bits (59), Expect = 3.7 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -2 Query: 450 LYGVLRDIHTRPLPIRYHLCLIQFSIIIN-LSSFP 349 + +L ++ RPL + YHLC I S I LS FP Sbjct: 433 MMALLGGMNPRPLSLVYHLCAITLSSIGQLLSPFP 467 >At5g24150.1 68418.m02839 squalene monooxygenase 1,1 / squalene epoxidase 1,1 (SQP1,1) identical to SP|O65404 Length = 516 Score = 27.5 bits (58), Expect = 4.9 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -2 Query: 450 LYGVLRDIHTRPLPIRYHLCLIQFSIIIN-LSSFP 349 + +L ++ RP+ + YHLC I S I + LS FP Sbjct: 432 MMALLGGMNPRPISLIYHLCAITLSSIGHLLSPFP 466 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,890,288 Number of Sequences: 28952 Number of extensions: 163134 Number of successful extensions: 252 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 252 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 811731120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -