BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0521 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 191 5e-49 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 191 5e-49 SB_56| Best HMM Match : Actin (HMM E-Value=0) 191 5e-49 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 191 5e-49 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 191 5e-49 SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 2e-26 SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) 88 5e-18 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 85 4e-17 SB_54| Best HMM Match : Actin (HMM E-Value=0) 84 1e-16 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 3e-16 SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6) 56 2e-08 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 49 4e-06 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 48 5e-06 SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 47 2e-05 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 46 4e-05 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 46 4e-05 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 46 4e-05 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 46 4e-05 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 46 4e-05 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 46 4e-05 SB_6274| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_876| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 45 5e-05 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 44 8e-05 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 44 1e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 44 1e-04 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17566| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_16765| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 44 1e-04 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) 44 1e-04 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 44 1e-04 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 43 2e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 43 2e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 43 2e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 43 2e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 43 2e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 43 2e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 43 2e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 43 2e-04 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 43 2e-04 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 43 2e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 43 2e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 43 2e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 43 2e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 43 2e-04 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 43 2e-04 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 43 2e-04 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 43 2e-04 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 43 2e-04 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 43 2e-04 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 43 2e-04 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 43 2e-04 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 43 2e-04 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 43 2e-04 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 43 2e-04 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 43 2e-04 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 43 2e-04 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 43 2e-04 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 43 2e-04 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 43 2e-04 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 43 2e-04 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 43 2e-04 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 43 2e-04 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 43 2e-04 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 43 2e-04 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 43 2e-04 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 43 2e-04 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 43 2e-04 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 43 2e-04 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42545| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42492| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 43 2e-04 SB_42077| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) 43 2e-04 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40885| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 43 2e-04 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39773| Best HMM Match : DUF765 (HMM E-Value=4.1) 43 2e-04 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 43 2e-04 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 43 2e-04 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37896| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37019| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 43 2e-04 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 191 bits (465), Expect = 5e-49 Identities = 85/86 (98%), Positives = 86/86 (100%) Frame = +1 Query: 256 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 435 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR Sbjct: 37 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 96 Query: 436 VAPEEHPVLLTEAPLNPKANREKMTR 513 VAPEEHPVLLTEAPLNPKANREKMT+ Sbjct: 97 VAPEEHPVLLTEAPLNPKANREKMTQ 122 Score = 98.3 bits (234), Expect = 5e-21 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +3 Query: 483 PQGQQREDDQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 650 P+ + + QIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYE Sbjct: 113 PKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE 168 Score = 71.3 bits (167), Expect = 6e-13 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +2 Query: 149 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 253 M D+E+AALVVDNGSGMCKAGFAGDDAPRAVFPSI Sbjct: 1 MEDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSI 35 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 191 bits (465), Expect = 5e-49 Identities = 85/86 (98%), Positives = 86/86 (100%) Frame = +1 Query: 256 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 435 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR Sbjct: 36 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 95 Query: 436 VAPEEHPVLLTEAPLNPKANREKMTR 513 VAPEEHPVLLTEAPLNPKANREKMT+ Sbjct: 96 VAPEEHPVLLTEAPLNPKANREKMTQ 121 Score = 98.3 bits (234), Expect = 5e-21 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +3 Query: 483 PQGQQREDDQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 650 P+ + + QIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYE Sbjct: 112 PKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE 167 Score = 68.5 bits (160), Expect = 4e-12 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 155 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 253 +++VAALVVDNGSGMCKAGFAGDDAPRAVFPSI Sbjct: 2 EDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 34 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 191 bits (465), Expect = 5e-49 Identities = 85/86 (98%), Positives = 86/86 (100%) Frame = +1 Query: 256 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 435 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR Sbjct: 36 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 95 Query: 436 VAPEEHPVLLTEAPLNPKANREKMTR 513 VAPEEHPVLLTEAPLNPKANREKMT+ Sbjct: 96 VAPEEHPVLLTEAPLNPKANREKMTQ 121 Score = 98.3 bits (234), Expect = 5e-21 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +3 Query: 483 PQGQQREDDQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 650 P+ + + QIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYE Sbjct: 112 PKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE 167 Score = 69.7 bits (163), Expect = 2e-12 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 155 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 253 ++EVAALVVDNGSGMCKAGFAGDDAPRAVFPSI Sbjct: 2 EDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 34 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 191 bits (465), Expect = 5e-49 Identities = 85/86 (98%), Positives = 86/86 (100%) Frame = +1 Query: 256 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 435 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR Sbjct: 37 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 96 Query: 436 VAPEEHPVLLTEAPLNPKANREKMTR 513 VAPEEHPVLLTEAPLNPKANREKMT+ Sbjct: 97 VAPEEHPVLLTEAPLNPKANREKMTQ 122 Score = 98.3 bits (234), Expect = 5e-21 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +3 Query: 483 PQGQQREDDQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 650 P+ + + QIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYE Sbjct: 113 PKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE 168 Score = 75.8 bits (178), Expect = 3e-14 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +2 Query: 149 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 253 MCD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSI Sbjct: 1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 35 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 191 bits (465), Expect = 5e-49 Identities = 85/86 (98%), Positives = 86/86 (100%) Frame = +1 Query: 256 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 435 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR Sbjct: 37 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR 96 Query: 436 VAPEEHPVLLTEAPLNPKANREKMTR 513 VAPEEHPVLLTEAPLNPKANREKMT+ Sbjct: 97 VAPEEHPVLLTEAPLNPKANREKMTQ 122 Score = 99.5 bits (237), Expect = 2e-21 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = +3 Query: 483 PQGQQREDDQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 650 P+ + + QIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYE Sbjct: 113 PKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYE 168 Score = 71.3 bits (167), Expect = 6e-13 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +2 Query: 149 MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 253 M D+++AALV+DNGSGMCKAGFAGDDAPRAVFPSI Sbjct: 1 MADDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSI 35 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 116 bits (278), Expect = 2e-26 Identities = 52/55 (94%), Positives = 52/55 (94%) Frame = +1 Query: 256 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF 420 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKI TF Sbjct: 36 GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIMFETF 90 Score = 95.1 bits (226), Expect = 4e-20 Identities = 43/48 (89%), Positives = 48/48 (100%) Frame = +3 Query: 507 DQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 650 ++IMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYE Sbjct: 83 EKIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE 130 Score = 69.7 bits (163), Expect = 2e-12 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 155 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 253 D++VAALV+DNGSGMCKAGFAGDDAPRAVFPSI Sbjct: 2 DDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSI 34 >SB_3885| Best HMM Match : Actin (HMM E-Value=0.77) Length = 152 Score = 88.2 bits (209), Expect = 5e-18 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 513 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 650 IMFE FN+PA+YVAIQAVLSLYASGRTTG+V DSGDGVSH VPIYE Sbjct: 1 IMFEAFNSPAVYVAIQAVLSLYASGRTTGVVFDSGDGVSHNVPIYE 46 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 85.4 bits (202), Expect = 4e-17 Identities = 35/56 (62%), Positives = 49/56 (87%) Frame = +3 Query: 483 PQGQQREDDQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 650 P+ + + ++ FETFN PA+++++QAVLSLYA+GRTTG+VLD+GDGVSH+VPIYE Sbjct: 138 PRRNREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDAGDGVSHSVPIYE 193 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +1 Query: 448 EHPVLLTEAPLNPKANREK 504 +HPVLLTEAPLNP+ NREK Sbjct: 126 QHPVLLTEAPLNPRRNREK 144 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 83.8 bits (198), Expect = 1e-16 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = +3 Query: 510 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 650 Q+MFE+FN P MYVA+QAV++LYASGRTTG V D GDGVSHTVP+Y+ Sbjct: 2166 QLMFESFNVPCMYVAVQAVMALYASGRTTGTVFDCGDGVSHTVPVYD 2212 Score = 54.4 bits (125), Expect = 8e-08 Identities = 27/49 (55%), Positives = 34/49 (69%) Frame = +1 Query: 400 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTRSCSKHSTRPPC 546 K+W H F ++LRV E+ PVLLTEAPLNPK NRE+M + + S PC Sbjct: 2130 KMWEHAF-DQLRVRGEDFPVLLTEAPLNPKMNRERMVQLMFE-SFNVPC 2176 Score = 45.2 bits (102), Expect = 5e-05 Identities = 17/27 (62%), Positives = 23/27 (85%) Frame = +2 Query: 173 LVVDNGSGMCKAGFAGDDAPRAVFPSI 253 +V+DNGSG CKAG + D++PR VFP+I Sbjct: 2097 VVIDNGSGFCKAGLSTDESPRVVFPAI 2123 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 82.2 bits (194), Expect = 3e-16 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 1/71 (1%) Frame = +1 Query: 298 KDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTF-YNELRVAPEEHPVLLTEA 474 KD VGDEA R +L + YP+++GIV NWDDM+ +W +TF +++ + P VLLTE Sbjct: 53 KDLMVGDEASQLRYMLEVNYPMDNGIVRNWDDMKHVWDYTFGESKMNIDPRNTKVLLTEP 112 Query: 475 PLNPKANREKM 507 PLNP NREKM Sbjct: 113 PLNPMKNREKM 123 Score = 67.7 bits (158), Expect = 8e-12 Identities = 28/56 (50%), Positives = 40/56 (71%) Frame = +3 Query: 483 PQGQQREDDQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 650 P + + ++MFE + +Y+AIQAVL+LYA G TG+V+DSGDGV+H P+YE Sbjct: 116 PMKNREKMIEVMFENYQFEGVYIAIQAVLTLYAQGLLTGVVIDSGDGVTHICPVYE 171 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +2 Query: 167 AALVVDNGSGMCKAGFAGDDAPRAVFPSIGEGPAIRA*WSVWD 295 + +V DNG+G K G+AG + P +FPS+ P IR+ V D Sbjct: 7 SVIVCDNGTGFVKCGYAGSNFPAHIFPSMVGRPIIRSSQKVGD 49 >SB_43920| Best HMM Match : SRP-alpha_N (HMM E-Value=4.6) Length = 372 Score = 56.4 bits (130), Expect = 2e-08 Identities = 26/60 (43%), Positives = 34/60 (56%) Frame = +1 Query: 286 GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL 465 G+ D ++GDEA K T K+PI H IV +WD ME+ W + LR PE+H LL Sbjct: 278 GVEDLDFFIGDEAIDKPSYAT-KWPIRHAIVEDWDLMERFWEQCIFKYLRAEPEDHYFLL 336 Score = 32.3 bits (70), Expect = 0.35 Identities = 11/17 (64%), Positives = 15/17 (88%) Frame = +3 Query: 594 TGIVLDSGDGVSHTVPI 644 TG V+DSGDGV+H +P+ Sbjct: 356 TGCVIDSGDGVTHVIPV 372 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 50.4 bits (115), Expect = 1e-06 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 PRP NSCSPGDPLVLERPPPR Sbjct: 24 PRPSNSCSPGDPLVLERPPPR 44 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 49.2 bits (112), Expect = 3e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P+P NSCSPGDPLVLERPPPR Sbjct: 12 PKPSNSCSPGDPLVLERPPPR 32 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 48.8 bits (111), Expect = 4e-06 Identities = 18/47 (38%), Positives = 34/47 (72%) Frame = +3 Query: 510 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE 650 ++MFE +N PA ++ +VL+ +A+GR+ G+V+DSG + VP+++ Sbjct: 54 ELMFEKYNVPAFFLCKNSVLTAFANGRSNGLVIDSGATQTSAVPVHD 100 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = +1 Query: 358 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 510 PI+ G++ +WD EKI + + ++ HP+L++EA N + REK+T Sbjct: 3 PIKDGMIEDWDLFEKILDYIYSKNIKSDSALHPLLMSEAAWNTRIKREKLT 53 >SB_14086| Best HMM Match : POR (HMM E-Value=7.7) Length = 292 Score = 48.4 bits (110), Expect = 5e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P P NSCSPGDPLVLERPPPR Sbjct: 166 PEPSNSCSPGDPLVLERPPPR 186 >SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 48.0 bits (109), Expect = 7e-06 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P P NSCSPGDPLVLERPPPR Sbjct: 18 PAPSNSCSPGDPLVLERPPPR 38 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 RP NSCSPGDPLVLERPPPR Sbjct: 16 RPSNSCSPGDPLVLERPPPR 35 >SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 47.6 bits (108), Expect = 9e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -1 Query: 80 DPRPPNSCSPGDPLVLERPPPR 15 DP NSCSPGDPLVLERPPPR Sbjct: 23 DPNTSNSCSPGDPLVLERPPPR 44 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 PR NSCSPGDPLVLERPPPR Sbjct: 8 PRASNSCSPGDPLVLERPPPR 28 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 PR NSCSPGDPLVLERPPPR Sbjct: 16 PRESNSCSPGDPLVLERPPPR 36 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -1 Query: 80 DPRPPNSCSPGDPLVLERPPPR 15 DP NSCSPGDPLVLERPPPR Sbjct: 42 DPARSNSCSPGDPLVLERPPPR 63 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 PR NSCSPGDPLVLERPPPR Sbjct: 57 PRRSNSCSPGDPLVLERPPPR 77 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/23 (86%), Positives = 21/23 (91%), Gaps = 1/23 (4%) Frame = -1 Query: 80 DPRPP-NSCSPGDPLVLERPPPR 15 D +PP NSCSPGDPLVLERPPPR Sbjct: 93 DAQPPSNSCSPGDPLVLERPPPR 115 >SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 +P NSCSPGDPLVLERPPPR Sbjct: 18 KPSNSCSPGDPLVLERPPPR 37 >SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 +P NSCSPGDPLVLERPPPR Sbjct: 8 KPSNSCSPGDPLVLERPPPR 27 >SB_32003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -1 Query: 80 DPRPPNSCSPGDPLVLERPPPR 15 D R NSCSPGDPLVLERPPPR Sbjct: 9 DDRTSNSCSPGDPLVLERPPPR 30 >SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 +P NSCSPGDPLVLERPPPR Sbjct: 44 KPSNSCSPGDPLVLERPPPR 63 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 183 PSNSCSPGDPLVLERPPPR 201 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 17 PSNSCSPGDPLVLERPPPR 35 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 26 PSNSCSPGDPLVLERPPPR 44 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 20 PSNSCSPGDPLVLERPPPR 38 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 63 PSNSCSPGDPLVLERPPPR 81 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 42 PSNSCSPGDPLVLERPPPR 60 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 19 PSNSCSPGDPLVLERPPPR 37 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 8 PSNSCSPGDPLVLERPPPR 26 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 56 PSNSCSPGDPLVLERPPPR 74 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 156 PSNSCSPGDPLVLERPPPR 174 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 20 PSNSCSPGDPLVLERPPPR 38 >SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) Length = 593 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 136 PSNSCSPGDPLVLERPPPR 154 >SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) Length = 129 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 5 PSNSCSPGDPLVLERPPPR 23 >SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 19 PSNSCSPGDPLVLERPPPR 37 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 28 PSNSCSPGDPLVLERPPPR 46 >SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 22 PSNSCSPGDPLVLERPPPR 40 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 7 PSNSCSPGDPLVLERPPPR 25 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 40 PSNSCSPGDPLVLERPPPR 58 >SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 14 PSNSCSPGDPLVLERPPPR 32 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 66 PSNSCSPGDPLVLERPPPR 84 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 55 PSNSCSPGDPLVLERPPPR 73 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 111 PSNSCSPGDPLVLERPPPR 129 >SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 8 PSNSCSPGDPLVLERPPPR 26 >SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 44 PSNSCSPGDPLVLERPPPR 62 >SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 7 PSNSCSPGDPLVLERPPPR 25 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P+ NSCSPGDPLVLERPPPR Sbjct: 14 PKRSNSCSPGDPLVLERPPPR 34 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P+ NSCSPGDPLVLERPPPR Sbjct: 12 PQKSNSCSPGDPLVLERPPPR 32 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 35 PSNSCSPGDPLVLERPPPR 53 >SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 14 PSNSCSPGDPLVLERPPPR 32 >SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 10 PSNSCSPGDPLVLERPPPR 28 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 14 PSNSCSPGDPLVLERPPPR 32 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 46 PSNSCSPGDPLVLERPPPR 64 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 13 PSNSCSPGDPLVLERPPPR 31 >SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 75 PSNSCSPGDPLVLERPPPR 93 >SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 7 PSNSCSPGDPLVLERPPPR 25 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 72 PSNSCSPGDPLVLERPPPR 90 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 29 PSNSCSPGDPLVLERPPPR 47 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 23 PSNSCSPGDPLVLERPPPR 41 >SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P+ NSCSPGDPLVLERPPPR Sbjct: 5 PQASNSCSPGDPLVLERPPPR 25 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 515 PSNSCSPGDPLVLERPPPR 533 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 53 PGDPLVLERPPPR 15 PGDPLVLERPPPR Sbjct: 664 PGDPLVLERPPPR 676 >SB_6274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 3 PSNSCSPGDPLVLERPPPR 21 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 14 PSNSCSPGDPLVLERPPPR 32 >SB_876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 19 PSNSCSPGDPLVLERPPPR 37 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -1 Query: 71 PPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 71 PSNSCSPGDPLVLERPPPR 89 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -1 Query: 80 DPRPPNSCSPGDPLVLERPPPR 15 +P NSCSPGDPLVLERPPPR Sbjct: 83 EPLSSNSCSPGDPLVLERPPPR 104 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.2 bits (102), Expect = 5e-05 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 3/25 (12%) Frame = -1 Query: 80 DPRPP---NSCSPGDPLVLERPPPR 15 DP+ P NSCSPGDPLVLERPPPR Sbjct: 11 DPKRPHRSNSCSPGDPLVLERPPPR 35 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 62 PETSNSCSPGDPLVLERPPPR 82 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 45.2 bits (102), Expect = 5e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -1 Query: 80 DPRPPNSCSPGDPLVLERPPPR 15 +P NSCSPGDPLVLERPPPR Sbjct: 5 EPLASNSCSPGDPLVLERPPPR 26 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 22 RASNSCSPGDPLVLERPPPR 41 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 160 PHLSNSCSPGDPLVLERPPPR 180 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 21 RESNSCSPGDPLVLERPPPR 40 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 21 RKSNSCSPGDPLVLERPPPR 40 >SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 76 RESNSCSPGDPLVLERPPPR 95 >SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 101 RTSNSCSPGDPLVLERPPPR 120 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 44.4 bits (100), Expect = 8e-05 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +2 Query: 17 AVAAALELVDPPGCRNSAAAD 79 AVAAALELVDPPGCRNS AAD Sbjct: 8 AVAAALELVDPPGCRNSIAAD 28 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 23 RQSNSCSPGDPLVLERPPPR 42 >SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 6 RTSNSCSPGDPLVLERPPPR 25 >SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -1 Query: 80 DPRPPNSCSPGDPLVLERPPPR 15 D + NSCSPGDPLVLERPPPR Sbjct: 18 DHKGSNSCSPGDPLVLERPPPR 39 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 51 RASNSCSPGDPLVLERPPPR 70 >SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 18 RESNSCSPGDPLVLERPPPR 37 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 13 RASNSCSPGDPLVLERPPPR 32 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 10 PMVSNSCSPGDPLVLERPPPR 30 >SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 2 RKSNSCSPGDPLVLERPPPR 21 >SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 5 RSSNSCSPGDPLVLERPPPR 24 >SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 10 RTSNSCSPGDPLVLERPPPR 29 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 19 PLASNSCSPGDPLVLERPPPR 39 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 9 RASNSCSPGDPLVLERPPPR 28 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 18 RASNSCSPGDPLVLERPPPR 37 >SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 4 RASNSCSPGDPLVLERPPPR 23 >SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 8e-05 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 8 PEISNSCSPGDPLVLERPPPR 28 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 380 RRSNSCSPGDPLVLERPPPR 399 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 6 RVSNSCSPGDPLVLERPPPR 25 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 2 PLVSNSCSPGDPLVLERPPPR 22 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 39 RGSNSCSPGDPLVLERPPPR 58 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 44 PGGSNSCSPGDPLVLERPPPR 64 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 2 RRSNSCSPGDPLVLERPPPR 21 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 39 RVSNSCSPGDPLVLERPPPR 58 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 183 RVSNSCSPGDPLVLERPPPR 202 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -1 Query: 80 DPRPPNSCSPGDPLVLERPPPR 15 +P NSCSPGDPLVLERPPPR Sbjct: 53 EPILSNSCSPGDPLVLERPPPR 74 >SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 4 PFSSNSCSPGDPLVLERPPPR 24 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -1 Query: 80 DPRPPNSCSPGDPLVLERPPPR 15 D NSCSPGDPLVLERPPPR Sbjct: 26 DHNQSNSCSPGDPLVLERPPPR 47 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = -1 Query: 77 PRP-PNSCSPGDPLVLERPPPR 15 P P NSCSPGDPLVLERPPPR Sbjct: 66 PHPRSNSCSPGDPLVLERPPPR 87 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 31 RVSNSCSPGDPLVLERPPPR 50 >SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 9 PVTSNSCSPGDPLVLERPPPR 29 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 5 RRSNSCSPGDPLVLERPPPR 24 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 7 RRSNSCSPGDPLVLERPPPR 26 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 24 RRSNSCSPGDPLVLERPPPR 43 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 1191 PFASNSCSPGDPLVLERPPPR 1211 Score = 31.1 bits (67), Expect = 0.81 Identities = 23/70 (32%), Positives = 29/70 (41%), Gaps = 11/70 (15%) Frame = +1 Query: 466 TEAPLNPKANR------EKMTRSCSKHSTRPPCTSPSKPCSRCTRPVVPPVSCWTPA--- 618 TEA +PKAN+ K T+ C PP P C+ P PPV PA Sbjct: 1336 TEAGKHPKANKVGKDKHNKGTKKCYGACAPPPMADP---CATMAAPCAPPVMMAAPAPML 1392 Query: 619 --TVSPTPCP 642 ++P P P Sbjct: 1393 APMLAPMPAP 1402 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 8 PGVSNSCSPGDPLVLERPPPR 28 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 57 PPVSNSCSPGDPLVLERPPPR 77 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 3 RVSNSCSPGDPLVLERPPPR 22 >SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 15 PITSNSCSPGDPLVLERPPPR 35 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 59 RRSNSCSPGDPLVLERPPPR 78 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 35 PALSNSCSPGDPLVLERPPPR 55 >SB_22214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 25 RGSNSCSPGDPLVLERPPPR 44 >SB_17566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 7 PYGSNSCSPGDPLVLERPPPR 27 >SB_16765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 10 RGSNSCSPGDPLVLERPPPR 29 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 2 RRSNSCSPGDPLVLERPPPR 21 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 7 RRSNSCSPGDPLVLERPPPR 26 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 8 RVSNSCSPGDPLVLERPPPR 27 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 70 RGSNSCSPGDPLVLERPPPR 89 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 43 PTISNSCSPGDPLVLERPPPR 63 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 23 RLSNSCSPGDPLVLERPPPR 42 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -1 Query: 80 DPRPPNSCSPGDPLVLERPPPR 15 D NSCSPGDPLVLERPPPR Sbjct: 21 DALSSNSCSPGDPLVLERPPPR 42 >SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) Length = 1392 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/32 (62%), Positives = 22/32 (68%) Frame = +2 Query: 158 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSI 253 E LV+D GS M K GFAGDDAP+ VFP I Sbjct: 1354 EAPTPLVIDVGSHMWKVGFAGDDAPKGVFPPI 1385 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -1 Query: 80 DPRPPNSCSPGDPLVLERPPPR 15 D NSCSPGDPLVLERPPPR Sbjct: 4 DDEISNSCSPGDPLVLERPPPR 25 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 53 PLLSNSCSPGDPLVLERPPPR 73 >SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 23 PFGSNSCSPGDPLVLERPPPR 43 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 31 RISNSCSPGDPLVLERPPPR 50 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 23 PLISNSCSPGDPLVLERPPPR 43 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 43.6 bits (98), Expect = 1e-04 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = +2 Query: 17 AVAAALELVDPPGCRNSAAADPSCAIAS 100 AVAAALELVDPPGCRNS A+ S +I S Sbjct: 8 AVAAALELVDPPGCRNSMNANVSYSIVS 35 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 14 PFRSNSCSPGDPLVLERPPPR 34 >SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 80 DPRPPNSCSPGDPLVLERPPPR 15 + + NSCSPGDPLVLERPPPR Sbjct: 46 EKKTSNSCSPGDPLVLERPPPR 67 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 77 PRPPNSCSPGDPLVLERPPPR 15 P NSCSPGDPLVLERPPPR Sbjct: 52 PFRSNSCSPGDPLVLERPPPR 72 >SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 74 RPPNSCSPGDPLVLERPPPR 15 R NSCSPGDPLVLERPPPR Sbjct: 13 RLSNSCSPGDPLVLERPPPR 32 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 13 NSCSPGDPLVLERPPPR 29 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 11 NSCSPGDPLVLERPPPR 27 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 36 NSCSPGDPLVLERPPPR 52 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 27 NSCSPGDPLVLERPPPR 43 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 4 NSCSPGDPLVLERPPPR 20 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 19 NSCSPGDPLVLERPPPR 35 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 80 NSCSPGDPLVLERPPPR 96 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 16 NSCSPGDPLVLERPPPR 32 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 350 NSCSPGDPLVLERPPPR 366 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 8 NSCSPGDPLVLERPPPR 24 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 7 NSCSPGDPLVLERPPPR 23 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 12 NSCSPGDPLVLERPPPR 28 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 103 NSCSPGDPLVLERPPPR 119 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 32 NSCSPGDPLVLERPPPR 48 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 8 NSCSPGDPLVLERPPPR 24 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 36 NSCSPGDPLVLERPPPR 52 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 5 NSCSPGDPLVLERPPPR 21 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 83 NSCSPGDPLVLERPPPR 99 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 3 NSCSPGDPLVLERPPPR 19 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 517 NSCSPGDPLVLERPPPR 533 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 15 NSCSPGDPLVLERPPPR 31 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 23 NSCSPGDPLVLERPPPR 39 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 32 NSCSPGDPLVLERPPPR 48 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 3 NSCSPGDPLVLERPPPR 19 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 23 NSCSPGDPLVLERPPPR 39 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 20 NSCSPGDPLVLERPPPR 36 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 4 NSCSPGDPLVLERPPPR 20 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 18 NSCSPGDPLVLERPPPR 34 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 8 NSCSPGDPLVLERPPPR 24 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 55 NSCSPGDPLVLERPPPR 71 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 5 NSCSPGDPLVLERPPPR 21 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 263 NSCSPGDPLVLERPPPR 279 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 26 NSCSPGDPLVLERPPPR 42 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 20 NSCSPGDPLVLERPPPR 36 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 12 NSCSPGDPLVLERPPPR 28 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 12 NSCSPGDPLVLERPPPR 28 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 12 NSCSPGDPLVLERPPPR 28 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 20 NSCSPGDPLVLERPPPR 36 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 14 NSCSPGDPLVLERPPPR 30 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 21 NSCSPGDPLVLERPPPR 37 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 18 NSCSPGDPLVLERPPPR 34 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 36 NSCSPGDPLVLERPPPR 52 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 19 NSCSPGDPLVLERPPPR 35 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 18 NSCSPGDPLVLERPPPR 34 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 17 NSCSPGDPLVLERPPPR 33 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 6 NSCSPGDPLVLERPPPR 22 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 5 NSCSPGDPLVLERPPPR 21 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 12 NSCSPGDPLVLERPPPR 28 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 49 NSCSPGDPLVLERPPPR 65 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 14 NSCSPGDPLVLERPPPR 30 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 114 NSCSPGDPLVLERPPPR 130 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 894 NSCSPGDPLVLERPPPR 910 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 15 NSCSPGDPLVLERPPPR 31 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 15 NSCSPGDPLVLERPPPR 31 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 95 NSCSPGDPLVLERPPPR 111 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 66 NSCSPGDPLVLERPPPR 82 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 16 NSCSPGDPLVLERPPPR 32 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 877 NSCSPGDPLVLERPPPR 893 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 8 NSCSPGDPLVLERPPPR 24 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 12 NSCSPGDPLVLERPPPR 28 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 64 NSCSPGDPLVLERPPPR 80 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 21 NSCSPGDPLVLERPPPR 37 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 65 NSCSPGDPLVLERPPPR 81 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 44 NSCSPGDPLVLERPPPR 60 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 27 NSCSPGDPLVLERPPPR 43 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 40 NSCSPGDPLVLERPPPR 56 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 16 NSCSPGDPLVLERPPPR 32 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 22 NSCSPGDPLVLERPPPR 38 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 25 NSCSPGDPLVLERPPPR 41 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 4 NSCSPGDPLVLERPPPR 20 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 41 NSCSPGDPLVLERPPPR 57 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 16 NSCSPGDPLVLERPPPR 32 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 143 NSCSPGDPLVLERPPPR 159 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 484 NSCSPGDPLVLERPPPR 500 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 3 NSCSPGDPLVLERPPPR 19 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 36 NSCSPGDPLVLERPPPR 52 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 82 NSCSPGDPLVLERPPPR 98 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 37 NSCSPGDPLVLERPPPR 53 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 62 NSCSPGDPLVLERPPPR 78 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 25 NSCSPGDPLVLERPPPR 41 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 5 NSCSPGDPLVLERPPPR 21 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 5 NSCSPGDPLVLERPPPR 21 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 55 NSCSPGDPLVLERPPPR 71 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 8 NSCSPGDPLVLERPPPR 24 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 3 NSCSPGDPLVLERPPPR 19 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 24 NSCSPGDPLVLERPPPR 40 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 23 NSCSPGDPLVLERPPPR 39 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 35 NSCSPGDPLVLERPPPR 51 >SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 3 NSCSPGDPLVLERPPPR 19 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 205 NSCSPGDPLVLERPPPR 221 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 15 NSCSPGDPLVLERPPPR 31 >SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 3 NSCSPGDPLVLERPPPR 19 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 4 NSCSPGDPLVLERPPPR 20 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 1023 NSCSPGDPLVLERPPPR 1039 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 18 NSCSPGDPLVLERPPPR 34 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 18 NSCSPGDPLVLERPPPR 34 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 122 NSCSPGDPLVLERPPPR 138 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 18 NSCSPGDPLVLERPPPR 34 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 5 NSCSPGDPLVLERPPPR 21 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 24 NSCSPGDPLVLERPPPR 40 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 13 NSCSPGDPLVLERPPPR 29 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 9 NSCSPGDPLVLERPPPR 25 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 64 NSCSPGDPLVLERPPPR 80 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 10 NSCSPGDPLVLERPPPR 26 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 6 NSCSPGDPLVLERPPPR 22 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 193 NSCSPGDPLVLERPPPR 209 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 44 NSCSPGDPLVLERPPPR 60 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 65 NSCSPGDPLVLERPPPR 15 NSCSPGDPLVLERPPPR Sbjct: 25 NSCSPGDPLVLERPPPR 41 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,563,628 Number of Sequences: 59808 Number of extensions: 582348 Number of successful extensions: 4135 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4106 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -